KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_3681Help
Entry
CDCO157_3681      CDS       T02122                                 

Gene name
uppP
Definition
(GenBank) undecaprenyl pyrophosphate phosphatase
  KO
K06153  undecaprenyl-diphosphatase [EC:3.6.1.27]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CDCO157_3681 (uppP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:elx01011]
    CDCO157_3681 (uppP)
Enzymes [BR:elx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.27  undecaprenyl-diphosphate phosphatase
     CDCO157_3681 (uppP)
Peptidoglycan biosynthesis and degradation proteins [BR:elx01011]
 Precursor biosynthesis
  Diphosphatase
   CDCO157_3681 (uppP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BacA
Motif
Other DBs
NCBI-ProteinID: AFJ30737
UniProt: A0A0F6C931
Structure
PDB: 

Position
complement(3870198..3871019)
Genome map
AA seq 273 aa AA seqDB search
MSDMHSLLIAAILGVVEGLTEFLPVSSTGHMIIVGHLLGFEGDTAKTFEVVIQLGSILAV
VVMFWRRLFGLIGIHFGRPLQHEGESKGRLTLIHILLGMIPAVVLGLLFHDTIKSLFNPI
NVMYALVVGGLLLIAAECLKPKEPRAPGLDDMTYRQAFMIGCFQCLALWPGFSRSGATIS
GGMLMGVSRYAASEFSFLLAVPMMMGATALDLYKSWGFLTSGDIPMFAVGFITAFVVALI
AIKTFLQLIKRISFIPFAIYRFIVAAAVYVVFF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatatgcactcgctgctgatagcggcaatattgggtgtggtcgaaggattgaca
gaatttctgccggtatccagcacgggccatatgattattgtcggtcacttgttggggttt
gagggcgacacggcgaaaacctttgaagttgtgatccagttaggatcaattctggcggta
gtagtgatgttctggcggcgtctgtttggcctgattggcatccactttggccgcccgttg
cagcacgaaggagaaagcaaaggtcgtttaacgctgatccacattttgctggggatgatt
ccggcggtggtactggggctgttgttccacgacacgattaagtcattgtttaacccgata
aatgtgatgtatgcgctggtcgttggcggtttgttgctgattgccgccgaatgcctgaag
ccgaaagagccgcgtgcgccgggtcttgatgatatgacctatcgtcaggcgtttatgatt
ggttgtttccagtgtctggcgctgtggccgggtttctcccgttccggggcgaccatttca
ggtgggatgctgatgggggtgagccgttacgctgcttccgagttttcgttcctgctggcg
gtgccgatgatgatgggcgcaacggcgctcgatctctacaaaagctggggcttcctgaca
agcggcgatatcccgatgtttgccgttgggtttatcaccgcttttgtggtggcgctgata
gcgattaaaaccttcctgcaattgattaagcgcatttcgtttatcccgttcgccatttat
cgctttattgtggcggctgcggtgtatgtcgtgttcttttaa

DBGET integrated database retrieval system