KEGG   Escherichia coli O157 H7 Xuzhou21 (EHEC): CDCO157_4915Help
Entry
CDCO157_4915      CDS       T02122                                 

Definition
(GenBank) ornithine carbamoyltransferase subunit I
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
elx  Escherichia coli O157:H7 Xuzhou21 (EHEC)
Pathway
elx00220  Arginine biosynthesis
elx01100  Metabolic pathways
elx01110  Biosynthesis of secondary metabolites
elx01130  Biosynthesis of antibiotics
elx01230  Biosynthesis of amino acids
Module
elx_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:elx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CDCO157_4915
Enzymes [BR:elx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     CDCO157_4915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AFJ31965
UniProt: A0A0F6CCK9
Structure
PDB: 

Position
complement(5220581..5221585)
Genome map
AA seq 334 aa AA seqDB search
MSGFYHKHFLKLLDFTPAELNSLLQLAAKLKADKKSGKEEAKLTGKNIALIFEKDSTRTR
CSFEVAAYDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGIQYRGYGQEIVETLAEY
AGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKPFNEMTLVYAGDARNNMGNSMLEAAALT
GLDLRLVAPQACWPEAALVTECRALAQQNGGNITLTEDVAKGVEGADFIYTDVWVSMGEA
KEKWAERIALLRDYQVNSKMMQLTGNPEVKFLHCLPAFHDDQTTLGKKMAEEFGLHGGME
VTDEVFESAASIVFDQAENRMHTIKAVMVATLSK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtccgggttttatcataagcatttcctgaaattactcgatttcacgccagctgaactc
aacagcctgctgcagttagccgcgaagctgaaagccgataagaaaagcggcaaagaagaa
gccaaactcactggtaaaaacatcgcgctcatcttcgaaaaagactcgacccgtacccga
tgctctttcgaagttgccgcatatgaccagggtgctcgcgttacttatctcggcccaagc
ggcagtcagattggtcataaagagtcgattaaagacactgcccgcgtgctgggtcgcatg
tatgacggtattcagtatcgcggctatggtcaggagattgtcgaaacactggcggaatac
gctggcgtgccggtatggaacggcctgaccaatgagtttcaccccacgcagttgctggcg
gatctcctcaccatgcaggagcatttacccggtaaaccattcaacgaaatgacgctggtc
tatgcaggtgacgcacgtaacaacatgggcaattcgatgctcgaagctgcggcgcttacc
ggtctggatttgcgtctggtcgcgccacaggcatgctggccggaagctgcgctggttacg
gaatgccgcgccctggcacaacaaaatggcgggaatattacgctgacggaagatgtagct
aaaggcgttgaaggtgctgactttatctataccgatgtatgggtgtcgatgggtgaagca
aaagaaaaatgggctgaacgcattgcattactgcgtgattatcaggtgaacagcaagatg
atgcagttgaccggtaacccggaggtcaaattcctccactgcctgcccgcgttccatgat
gaccaaacgacgcttggcaagaaaatggcggaagagtttggcctacatggcggaatggaa
gtgactgatgaggtcttcgaatctgccgccagcattgtttttgatcaggcggaaaaccgc
atgcacaccatcaaagcggtgatggtcgcgacactcagtaaataa

DBGET integrated database retrieval system