KEGG   Elizabethkingia sp. 2-6: FCS00_01660
Entry
FCS00_01660       CDS       T06039                                 

Definition
(GenBank) flavastacin
  KO
K20138  flavastacin [EC:3.4.24.76]
Organism
elz  Elizabethkingia sp. 2-6
Brite
KEGG Orthology (KO) [BR:elz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:elz01002]
    FCS00_01660
Enzymes [BR:elz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.76  flavastacin
     FCS00_01660
Peptidases and inhibitors [BR:elz01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   FCS00_01660
SSDB
Motif
Pfam: Astacin RicinB_lectin_2 Ricin_B_lectin DUF3810 Reprolysin_5 Peptidase_M91
Other DBs
NCBI-ProteinID: QCO45137
UniProt: A0A4P8E2X2
Position
complement(356104..357435)
AA seq 443 aa
MTRKLLILSGCLVLALNSCKSDIETTPASSVDHTTTQLNGTTIHKLLINGAYTYVNEVNG
EYFYADDITITAEQFNQLKRMANPDISTVERSTIVSSFIKTWPNATVYYTLPSQGSLSTQ
AYNTFLTNINKAFDMISSKTSVKFIQRTNQTEYITFTYSTGNSSPLGWVKNRVNGIKIYN
TTYPAIIAHEIMHSMGIMHEQCRPDRDQYIIVDTNRAQDGTRHNFNLYNDYAGHGEFDFG
SVMMYKSTDFAIDPNLPVMTKLDGSTFGKQRDGLSAGDYAGINHLYGPVNSTSATNGTYT
LTTSLAGDKNVDITGSSTADGTNVILYSASTGNNQKFIFRKSEHGYFTIKSILDSTKVLT
VRNNGTANGTAVELRTNADTDSQKWLLFNLGNEGFGFAPKNAPSLRLEVKDGLTTNLTPI
VIGSTDQTLQPYTKQRFTLTKVN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgacacgtaaactattaatcttatcaggctgtctggttctggctctgaattcttgtaag
tcggatattgaaactactcccgcaagttcggttgatcatacaacaacccagctgaacgga
acaaccattcacaaattgctaattaacggagcttacacttatgtaaatgaagttaatggt
gagtacttttacgctgatgatattacaatcacggcggagcagtttaaccagttgaagaga
atggccaatccggatatatctacagttgagcgtagtacaattgtaagctcttttatcaaa
acatggccaaatgcaacagtttactatactttacctagtcagggaagtttaagtactcag
gcctataatacattccttacgaatattaacaaagcgtttgatatgatctcttcaaaaacc
agtgttaagttcattcaacgtaccaatcaaactgaatacattacatttacttattccaca
ggaaacagttccccattgggttgggtaaaaaacagagtaaatggtattaaaatatacaat
acaacttatccggcaattattgcacacgagattatgcactcgatggggattatgcatgaa
cagtgccgtccggacagggatcagtatattatagtagataccaacagagcacaggatggt
acccgtcacaatttcaatctttataacgattatgcaggacacggagaattcgactttggt
tcggtgatgatgtataaatctacagactttgctatagatcctaatctgcctgtaatgaca
aaactggatggttctacattcggcaagcaaagagatggactgtctgcaggtgattatgca
ggtatcaatcatttgtatggaccagtaaactccacatctgctactaacggtacgtataca
cttacaacttctttagcaggtgataaaaatgttgatattaccggaagctcaacagctgat
ggcaccaatgtaattttatattcggcttctacaggaaataatcagaaatttatcttccgc
aaatcagagcatggttattttaccattaagtcaatactggattctacaaaagtattaacg
gtaaggaacaatggaacagcaaacggaacggctgtagagctaagaactaatgcggatacg
gatagtcagaaatggttgttatttaatttaggaaatgaaggttttggttttgctcctaaa
aatgctccatctttaagactagaggtaaaagacggtctgacaactaatcttactccgata
gttattggcagtacagatcagacactccagccttacacaaaacagcgctttacacttacc
aaagtaaactaa

DBGET integrated database retrieval system