KEGG   Elizabethkingia sp. 2-6: FCS00_18035Help
Entry
FCS00_18035       CDS       T06039                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
elz  Elizabethkingia sp. 2-6
Pathway
elz00480  Glutathione metabolism
elz00590  Arachidonic acid metabolism
elz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    FCS00_18035
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FCS00_18035
Enzymes [BR:elz01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FCS00_18035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin RuvX
Motif
Other DBs
NCBI-ProteinID: QCO48169
UniProt: A0A4P8EAP3
Position
3911636..3912169
Genome map
AA seq 177 aa AA seqDB search
MKKFLLFALSVAGVLFIAAQSKTIYSYKVEGLTGDEIDFSKFKGKKILVVNTASKCGFTP
QYADLEKIYQDYKDKLVIVGFPANNFGQQEPGTNEDIHSFCEANYGVSFPMAAKVSVKGE
DIAPIFKFLTEKKLNGVKDTDIAWNFTKFLLDDKGKLINSFPSKVKPTDEAIVKYLK
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttcttattatttgcattgtctgtggcaggagttctttttattgcagcacaa
agcaagactatctatagctataaagtggaaggacttacaggtgacgaaattgatttctct
aaattcaaagggaaaaagattcttgtggtaaacactgcttctaaatgtggtttcacacct
cagtatgcagacctggagaaaatctaccaggattataaagataaattggttattgttggt
ttcccggcaaataattttgggcagcaggaaccaggaaccaatgaagatattcatagcttc
tgtgaggctaattacggagtatctttccctatggctgcgaaagtttctgtaaaaggagaa
gatattgcaccaatatttaaattccttacagaaaagaaactaaacggagtaaaagacact
gatattgcatggaacttcacgaagtttttactggatgacaaaggaaagttaatcaactca
ttcccgagtaaagtaaaacctacagacgaggctattgtaaaatacctgaaatag

DBGET integrated database retrieval system