KEGG   Escherichia marmotae: C1192_00850Help
Entry
C1192_00850       CDS       T05353                                 

Gene name
mqo
Definition
(GenBank) malate dehydrogenase (quinone)
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ema  Escherichia marmotae
Pathway
ema00020  Citrate cycle (TCA cycle)
ema00620  Pyruvate metabolism
ema01100  Metabolic pathways
ema01110  Biosynthesis of secondary metabolites
ema01120  Microbial metabolism in diverse environments
ema01130  Biosynthesis of antibiotics
ema01200  Carbon metabolism
Module
ema_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ema_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    C1192_00850 (mqo)
   00620 Pyruvate metabolism
    C1192_00850 (mqo)
Enzymes [BR:ema01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     C1192_00850 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AUT25837
Position
175024..176670
Genome map
AA seq 548 aa AA seqDB search
MKKVTAMLFSMAVGLNAVSMTAKAKASEEQETDVLLIGGGIMSATLGTYLRELEPEWSMT
MVERLEGVAQESSNGWNNAGTGHSALMELNYTPQNADGSISIEKAVAINEAFQISRQFWA
HQVERGVLRTPRSFINTIPHMSFVWGEDNVNFLRARYAALQQSSLFRGMRYSEDHAQIKE
WAPLVMEGRDPQQKVAATRTEIGTDVNYGEITRQLIASLQKKSNFSLQLSSEVRAIKRND
DNTWTVTVADLKNGTAQNIRAKFVFIGAGGAALKLLQESGIPEAKEYAGFPVGGQFLVSE
NPDVVNHHLAKVYGKASVGAPPMSVPHIDTRVLDGKRVVLFGPFATFSTKFLKNGSLWDL
MSSTTTSNVMPMIHVGLDNFDLVKYLVSQVMLSEEDRFEALKEYYPQAKKEDWRLWQAGQ
RVQIIKRDADKGGVLRLGTEVVSDQQGTIAALLGASPGASTAAPIMLSLLEKVFGDRVSS
PQWQATLKAIVPSYGSKLNGDAAATERELQYTSEVLSLKYDKPQAADSTPKAQLKPQPVQ
KEVADIAL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgactgccatgctcttctcgatggccgtggggcttaatgccgtttcaatg
acggcaaaagcgaaagcgtccgaggagcaggaaactgatgtactgttgattggcggcggc
attatgagcgccacgttggggacctatttacgggagctggagcctgaatggtcgatgacc
atggtagagcgcctggagggtgtcgcgcaggagagttcgaacggctggaacaacgccgga
accgggcattctgcgctgatggaactcaattacaccccgcaaaacgccgatggcagcatc
agtattgaaaaagcagtcgccattaacgaagcattccagatttcccgccagttctgggcg
caccaggtcgagcgcggcgtgctgcgtaccccgcgttcatttatcaataccattccgcat
atgagctttgtctggggcgaagataacgtcaatttcctgcgtgcccgttacgcggcattg
caacaaagttcgctgtttcgcggtatgcgttactctgaagatcacgcgcaaatcaaggag
tgggcaccgttagtgatggaagggcgtgatccacaacagaaagtggcggctacgcgtaca
gaaattggcaccgatgtgaactacggtgagatcacccgtcagttgattgcctcattacag
aagaaatctaacttctcgctgcaactcagcagcgaagtccgcgctatcaaacgtaatgac
gataacacctggactgtcactgttgccgatctgaaaaacggcaccgcacagaacatccgt
gcgaaatttgtctttatcggcgcgggtggcgcggcactgaaactgttgcaggagtccggt
attccggaagcgaaagaatacgccggtttcccggtgggcggtcagttcctcgtttcggaa
aacccggatgtggttaatcaccatctggcgaaggtctatggtaaagcatccgttggcgcg
ccgccgatgtcagttccgcatatcgatacccgtgtactggacggtaaacgcgtggtgctg
ttcgggccatttgctaccttctcaaccaaattcctcaaaaacggttcgctgtgggatctg
atgagttccaccaccacctctaacgtgatgccgatgatacacgtcgggctggataatttc
gatctggtgaaatatctggtgagtcaggtgatgttgagtgaagaggatcgttttgaagcg
ttgaaagagtactacccacaagcgaaaaaagaggactggcgtttgtggcaagcgggacag
cgcgtgcagattatcaaacgtgatgccgataaaggcggcgtgctgcgtctgggtacagaa
gtggtcagcgaccagcaaggaaccattgctgcgctgctcggcgcatcgccgggggcatct
accgctgcgccgattatgttgagtctgttggaaaaagtgtttggtgatcgtgtttccagc
ccacaatggcaggccacgctgaaagcaattgttccgtcttatggcagcaagctgaacggt
gatgcggcggcaacagaacgtgaattgcagtacaccagcgaagttctgagcctgaaatat
gataagccgcaggcggcagatagcacgccgaaagcgcagttgaaaccgcaaccagtacaa
aaagaagtggcggatattgcgttgtaa

DBGET integrated database retrieval system