KEGG   Escherichia marmotae: C1192_07200Help
Entry
C1192_07200       CDS       T05353                                 

Definition
(GenBank) bifunctional glucose-1-phosphatase/inositol phosphatase
  KO
K01085  glucose-1-phosphatase [EC:3.1.3.10]
Organism
ema  Escherichia marmotae
Pathway
ema00010  Glycolysis / Gluconeogenesis
ema01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C1192_07200
Enzymes [BR:ema01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     C1192_07200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AUT26917
UniProt: A0A2B7LQL7
Position
complement(1345084..1346325)
Genome map
AA seq 413 aa AA seqDB search
MKKTLIAAAVAGMVLLSSNAQAQTVPEGYQLQQVLLMSRHNLRAPLANNGSVLEQSTPNK
WPQWDVPGGQLTTKGGVLEVYMGHYMREWLAEQGMVKSGECPPPDTVYAYANSLQRTVAT
AQFFITGAFPGCDIPVHHQEKMGTMDPTFNPVITDDSAAFSEQAVAAMEKELSKLQLTDS
YQLLEKIVNYKDSPACKEKQQCSLVDGKNTFSAKYQQEPGVSGPLKVGNSLVDAFTLQYY
EGFPMDQVAWGEIKSDQQWKVLSKLKNGYQDSLFTSPEVARNVAKPLVSYIDKALVTDRA
SAPKITVLVGHDSNIASLLTALDFKPYQLHDQNERTPIGGKIVFQRWHDSKANRDLMKIE
YVYQSSQQLRNADALTLQAPAQRVTLELTGCPIDANGFCPMDKFDSVLNEAVK
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgctaatcgctgcggccgtggctggaatggttttactctcttcgaatgct
caggcacagacagtgccggaaggctatcagctacagcaagtgctactcatgagccgtcat
aacttacgtgcgccgctggcaaataatggcagcgtgcttgagcagtccacgccgaataaa
tggccgcaatgggatgtccccggagggcaactcaccaccaaaggcggcgtgctggaagtg
tatatgggccattacatgcgtgaatggctggcagagcaggggatggtgaaatcgggcgaa
tgtccgccaccggacaccgtttacgcctacgcgaacagcctgcaacgtaccgtcgccact
gcgcagttctttattactggcgcattcccggggtgtgatattcctgttcatcatcaggaa
aaaatgggcacgatggacccaacctttaacccggtaatcaccgatgattccgctgcattc
agcgagcaggcagtggcagcaatggaaaaagagttgagtaaactccagcttaccgacagc
taccagctactggaaaaaatcgttaactataaagattctccggcctgtaaagaaaaacag
cagtgttcactggtggatggcaaaaatacttttagcgcgaaatatcaacaagagccgggc
gtttccgggccgttgaaggtgggcaactcgctggtggatgcgtttactttgcaatactac
gaaggtttcccgatggatcaggtggcctggggagagatcaaatcagatcaacagtggaag
gtgttgtcgaaactgaaaaacggttaccaggatagcctgtttacttcaccggaagtggcg
cgcaatgtcgcgaaaccgctggtgagctacatcgacaaagccctggtcaccgatcgcgcc
agtgcgccgaagattacggtgttggtaggacacgactctaacattgcctcgctactcact
gcgctggatttcaaaccgtatcaactgcatgaccagaatgaacgtacgcccattggtggc
aagattgtcttccagcgttggcatgacagcaaagccaatcgtgatttgatgaaaatcgag
tatgtgtaccagagttcgcagcagttgcgtaatgccgacgccttaaccctgcaagcacct
gctcagcgcgtgacgctggaacttactggctgcccgatagatgccaacggattttgcccg
atggataagtttgatagcgtgttgaatgaggcagtgaaataa

DBGET integrated database retrieval system