KEGG   Escherichia marmotae: C1192_14855Help
Entry
C1192_14855       CDS       T05353                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
ema  Escherichia marmotae
Pathway
ema00010  Glycolysis / Gluconeogenesis
ema00020  Citrate cycle (TCA cycle)
ema00620  Pyruvate metabolism
ema01100  Metabolic pathways
ema01110  Biosynthesis of secondary metabolites
ema01120  Microbial metabolism in diverse environments
ema01130  Biosynthesis of antibiotics
ema01200  Carbon metabolism
Module
ema_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C1192_14855 (pckA)
   00020 Citrate cycle (TCA cycle)
    C1192_14855 (pckA)
   00620 Pyruvate metabolism
    C1192_14855 (pckA)
Enzymes [BR:ema01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     C1192_14855 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: AUT28247
UniProt: A0A2B7LSX2
Position
2851890..2853512
Genome map
AA seq 540 aa AA seqDB search
MRVNNGLTPQELEAYGISDVHDIVYNPSYDLLYQEELDPNLTGYERGVLTNLGAVAVDTG
IFTGRSPKDKYIVRDDTTRDTFWWADKGKGKNDNKPLSPETWQHLKGLVTKQLSGKRLFV
VDAFCGANPDTRLSVRFITEVAWQAHFVKNMFIRPSDEELEDFKPDFIVMNGAKCTNPQW
KEQGLNSENFVAFNLTERMQLIGGTWYGGEMKKGMFSMMNYLLPLKGIASMHCSANVGEK
GDVAVFFGLSGTGKTTLSTDPKRRLIGDDEHGWDDDGVFNFEGGCYAKTIKLSKEAEPEI
YNAIRRDALLENVTVREDGTIDFDDGSKTENTRVSYPIYHIENIVKPVSKAGHATKVIFL
TADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGITEPTPTFSACFGAAFLSLHPTQ
YAEVLVKRMQAAGAQAYLVNTGWNGTGKRISIKDTRAIIDAILNGSLDNAETFTLPMFNL
AIPTELPGVDTKILDPRNTYASPEQWQEKAETLAKLFIDNFDKYTDTPAGAALVAAGPKL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttaacaatggtttgaccccgcaagaactcgaggcttatggtatcagtgacgta
catgatatcgtttacaacccaagctatgatctgttgtatcaggaagagcttgatccaaac
ctgaccggttatgagcgcggggtgttaactaacctgggtgctgttgccgtcgataccggg
atcttcaccggccgctcaccaaaagataagtatatcgtccgtgacgatactacccgcgat
accttctggtgggccgacaaaggcaaaggtaagaacgacaacaaacctctctctccggaa
acctggcagcatctgaaaggcctggtgaccaaacagctttccggcaaacgcctgtttgtc
gttgacgctttctgtggcgctaacccggacactcgcctttccgtgcgtttcatcaccgaa
gtggcctggcaggcgcatttcgtcaagaacatgtttattcgcccgagtgatgaagagctg
gaagatttcaaaccagactttatcgtcatgaacggcgcgaagtgcaccaacccgcagtgg
aaagaacagggtctgaactctgaaaacttcgttgcgtttaacctgactgagcgcatgcag
ttgattggtggcacctggtacggcggtgagatgaagaaagggatgttctcaatgatgaac
tacctgctgccgctgaaaggcattgcctccatgcactgctccgccaacgttggcgagaaa
ggcgatgttgcggtgttcttcggcctttccggcaccggtaaaaccaccctttccaccgac
ccgaaacgtcgcctgattggcgatgacgagcacggctgggatgatgacggcgtatttaac
ttcgaaggcggctgctacgcgaaaaccatcaagctgtcgaaagaagcagaacccgaaatc
tacaacgccatccgtcgcgatgcgctgctggaaaacgtcaccgtgcgtgaagatggcact
atcgactttgatgatggttcaaaaaccgagaatacccgcgtttcttatccgatctatcat
atcgaaaacatcgttaagccagtctccaaagcgggccacgcgactaaagtgatcttcctg
accgcagatgcttttggcgtactgccgccggtttctcgcctgactgccgatcaaacccag
taccacttcctctcaggcttcaccgccaaactggccggtactgagcgtggcatcaccgaa
ccgacgccaaccttctctgcctgtttcggcgcggcattcctgtcgctgcacccgactcag
tacgcagaagtgctggtgaaacgtatgcaggcggcgggtgcgcaggcatatctcgttaac
accggctggaacggcactggcaaacgtatctccattaaagatacccgcgccattatcgat
gccatcctgaacggttcgctggataacgcagaaaccttcaccctgccgatgtttaacctg
gcgatcccaaccgagctgccgggcgtagatacgaagatcctcgatccgcgtaacacctac
gcttccccggaacagtggcaggaaaaagctgaaacgctggcgaaactgtttatcgacaac
ttcgataaatacaccgacacccctgcgggtgccgcgctggtcgctgctggcccgaagctg
taa

DBGET integrated database retrieval system