KEGG   Escherichia marmotae: C1192_14870Help
Entry
C1192_14870       CDS       T05353                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ema  Escherichia marmotae
Pathway
ema02020  Two-component system
ema02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ema00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C1192_14870
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    C1192_14870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ema02022]
    C1192_14870
Two-component system [BR:ema02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   C1192_14870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: AUT28250
UniProt: A0A370VCH7
Position
complement(2855419..2856138)
Genome map
AA seq 239 aa AA seqDB search
MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPG
EDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
RRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPL
SRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPDGSKA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaagagaactacaagattctggtggtcgatgacgacatgcgcctgcgcgcgctgctg
gagcgttatctcaccgaacaaggcttccaggttcgaagcgtcgctaatgcagaacagatg
gatcgcctgctcacccgtgaatctttccatcttatggtactggatttgatgttacctggt
gaagatggcttgtcgatttgccgacgtcttcgtagccagagtaacccgatgccgatcatt
atggtgacggcgaaaggggaagaagttgaccgtatcgttggcctggagattggcgctgac
gattacattccgaaaccgtttaacccacgtgaactgctggctcgtattcgtgcggtactg
cgtcgtcaggcgaacgagttgccgggcgcgccgtcgcaggaagaagcggtaattgctttc
ggtaagttcaaacttaacctcggtacgcgcgaaatgttccgtgaagatgagccgatgccg
ctcaccagcggtgaatttgcggtactgaaggcgctggtcagtcatccgcgtgagccgctc
tcccgcgataaattgatgaaccttgcccgtggacgtgaatattccgcaatggaacgctcc
atcgacgtgcagatctcgcgtctgcgccgcatggtggaagaagatccggcgcacccacgt
tacattcagaccgtctggggtctgggctacgtcttcgtgccggacggttctaaagcatga

DBGET integrated database retrieval system