KEGG   Escherichia marmotae: C1192_17645Help
Entry
C1192_17645       CDS       T05353                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
ema  Escherichia marmotae
Pathway
ema00051  Fructose and mannose metabolism
ema01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C1192_17645
Enzymes [BR:ema01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     C1192_17645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N AfaD Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AUT28735
Position
complement(3417596..3418744)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTV
SGVDAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGLVKRKEQGNASPLNIIAC
ENMVRGTTQLKGHVMNALPEEAKAWVEEHVGFVDSAVDRIVPPSASATNDPLEVTVETFS
EWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVKGAMEESGAVLIKRYSFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLVKPLLGTLEYGLPHKNLIQGIAAAMHFRSEEDPQAQELAALIADKGPQAALAQ
ISGLDANSEVVTEAVTAYNAMQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaacatcggtcgtggctttatcggtaaactgctg
gctgatgcgggtattcaactgacatttgccgatgtcaatcaggtggtacttgatgccctg
aatgcccgtcatagctaccaggttcatgtggtcggtgaaaccgagcaggtcgataccgtt
tccggcgttgatgccgtcagcagtattggtgatgacgtggtggatttaatcgctcaggtc
gatttagtcactaccgccgttggtccggtcgtgctggaacgaattgctccggcgattgct
aaagggctggtgaaacgcaaagaacaaggtaatgcatccccactgaacatcatcgcgtgt
gaaaacatggttcgcggcaccactcagttgaaaggccatgtaatgaatgccctgccggaa
gaagcaaaagcgtgggttgaagaacacgttggctttgtcgattccgccgttgaccgcatc
gtgccaccttctgcttctgcaaccaacgatccgctggaagtgacggtagaaaccttcagc
gaatggattgtcgataaaactcaattcaaaggcgcgctgccaaacatcccaggtatggag
ctaaccgacaacctgatggcatttgttgagcgtaaactcttcaccctgaatacgggccat
gctataaccgcgtacctcggaaaactggcgggtcatcagaccattcgtgacgcaattctc
gatgagaaaatccgtgcggtggtaaaaggtgcgatggaagaaagcggcgcggtgctaatc
aagcgctacagttttgatgctgataaacatgctgcgtatatccagaaaatcctcggccgt
tttgaaaacccgtatctgaaagatgatgtggagcgtgtaggccgtcagccgctgcgtaaa
ctgagcgccggagatcgtctggtaaaaccgctgctgggtacgctggagtacggtttaccg
cacaaaaacctgattcagggtattgctgccgccatgcacttccgcagtgaagaagatcca
caggctcaggaactggctgcgctgattgccgacaaagggccgcaggctgcgctggcacag
atttccgggcttgatgccaacagcgaggttgtcacagaagcggtaaccgcttataacgca
atgcaataa

DBGET integrated database retrieval system