KEGG   Escherichia marmotae: C1192_17935Help
Entry
C1192_17935       CDS       T05353                                 

Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
ema  Escherichia marmotae
Pathway
ema00270  Cysteine and methionine metabolism
ema00450  Selenocompound metabolism
ema00920  Sulfur metabolism
ema01100  Metabolic pathways
ema01110  Biosynthesis of secondary metabolites
ema01130  Biosynthesis of antibiotics
ema01230  Biosynthesis of amino acids
Module
ema_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    C1192_17935
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    C1192_17935
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    C1192_17935
Enzymes [BR:ema01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     C1192_17935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AUT28785
Position
3476530..3477690
Genome map
AA seq 386 aa AA seqDB search
MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRA
LAELEGGAGAVLTNTGMSAIHLVTTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVL
FVDQGDEQALQAALAEKPKLVLVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPA
LQNPLALGADLVLHSCTKYLNGHSDVVAGVVIAKDPDVVTELAWWANNIGVTGGAFDSYL
LLRGLRTLVPRMDLAQRNAQAIVKYLQTQPLVKKLYHPSLPENQGHEIAVRQQKGFGAML
SFELDGDEQMLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLL
RISTGIEDGEDLIADLENGFRAANKG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtaaacaggccaccatcgcagtgcgtagcgggttaaatgacgacgaacagtat
ggttgcgttgtcccaccgatccatctttccagcacctataattttaccggatttaatgaa
ccgcgtgcgcatgattactcgcgtcgcggcaacccgacgcgcgatgtcgtgcagcgtgcg
ctggcagaactggaaggtggcgctggcgcggtgcttactaataccggcatgtcagccatc
catctggtgactaccgtctttttgaagccgggcgatctgttggttgcgccgcacgattgt
tacggcggcagctatcgtctgttcgacagtctggcgaaacgtggttgttatcgcgtgctg
tttgttgatcaaggtgatgagcaggcattacaagcggcactggcagaaaagcccaaactg
gtgttggtagaaagccccagtaatccattgttacgcgtcgtggatattgcgaaaatctgc
catctggcaagggaagttggggcggtgagcgtggtggataacaccttcttaagcccggca
ttacaaaatccgctggcattgggtgccgatctggtgttgcattcatgtacgaaatatctg
aatggccactctgacgtagtggctggcgtggtgattgctaaagatccggatgtggtcacc
gaactggcctggtgggcaaacaatattggcgtgacgggtggtgcgtttgacagttatttg
ttgctgcgtggtctgcgaactctggttccgcgtatggacctggctcagcgcaacgcgcag
gcgattgtgaaatatctgcaaacccaaccgctggtgaaaaaactttatcacccgtcgctg
ccggaaaatcaggggcatgaaattgccgtgcgtcagcaaaaaggctttggcgcaatgttg
agttttgaactggatggtgatgagcagatgctgcgtcgcttcctgggcgggctgtcgtta
tttacgctggcggaatcattagggggagtggaaagtttaatctctcacgccgcaaccatg
acccacgcaggcatggcaccagaagcgcgtgctgccgccgggatctccgagacgctgttg
cgtatctccaccggtattgaagatggcgaagatttaattgccgacctggaaaatggcttc
cgggctgcaaacaaggggtaa

DBGET integrated database retrieval system