KEGG   Escherichia marmotae: C1192_18410Help
Entry
C1192_18410       CDS       T05353                                 

Definition
(GenBank) PTS system mannose/fructose/N-acetylgalactosamine-transporter subunit IIB
  KO
K02813  sorbose PTS system EIIB component [EC:2.7.1.206]
Organism
ema  Escherichia marmotae
Pathway
ema00051  Fructose and mannose metabolism
ema01100  Metabolic pathways
ema02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C1192_18410
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    C1192_18410
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ema02000]
    C1192_18410
Enzymes [BR:ema01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     C1192_18410
Transporters [BR:ema02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    C1192_18410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AUT28861
Position
complement(3585876..3586370)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNIGGMAWRPGKKQLTKAV
SLDDDDINAFHELNNLGVTLDLRVVASDPSINIINKIKEHLVAN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgcctgatccacggccaggtcaccaccgtc
tggtcgaaagtggctaacgcccagcgcattattatctgcaatgacgaagtttataacgat
gaagttcgccggacattattgcgccaggccgccccgccgggaatgaaagttaacgtggtc
aatattgaaaaagcagtcgcggtgtatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcacccgacctcaggatgccttagcgatggttcgccagggcgtaaaaatcggc
accctgaatattggcggaatggcctggcggcccggtaaaaaacagttaaccaaagcggtt
tcattagatgacgatgatattaacgcatttcatgagttaaataatcttggcgtcacgctg
gatttacgcgttgtcgcgtcagatccttcaatcaatattattaacaaaataaaagaacac
ttagtcgcaaattaa

DBGET integrated database retrieval system