KEGG   Escherichia marmotae: C1192_21285
Entry
C1192_21285       CDS       T05353                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ema  Escherichia marmotae
Pathway
ema00230  Purine metabolism
ema01100  Metabolic pathways
ema01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C1192_21285
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AUT29360
Position
complement(4167594..4168073)
AA seq 159 aa
MNHSKSITIECVINGMPFQLHAAPGMPLSEMLREQGLLSVKQGCCVGECGACTVLVDGTA
TDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEETK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcaaaagtattaccattgaatgtgtcattaacggtatgccttttcagctt
cacgccgcaccaggaatgccactttcggagatgctccgcgaacaaggactgcttagtgtc
aagcaaggttgctgcgttggcgaatgcggtgcctgtacagtactggttgacggaacggca
accgacagttgtttatacctggccgcatgggctgaaggaaaagagatccgcacgctggaa
ggcgaagcaaaaggtggcaaactttctcatgttcaacaggcttatgcgaaatccggcgca
gtgcagtgtggcttttgtacgccagggttgattatggccaccacggcaatgctggcgaaa
ccacgagagaaaccattaaccattacggagattcgtcgtggcctggcgggaaatctctgt
cgctgcaccggttatcagatgattgtgaatacagtactggactgcgaagaaacgaagtaa

DBGET integrated database retrieval system