KEGG   Escherichia marmotae: C1192_21295
Entry
C1192_21295       CDS       T05353                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
ema  Escherichia marmotae
Pathway
ema00230  Purine metabolism
ema01100  Metabolic pathways
ema01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ema00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    C1192_21295
Enzymes [BR:ema01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     C1192_21295
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AUT29362
Position
complement(4168959..4171256)
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAAQLVSIEWQELPVITTPEAALAEDAAKIHSRGNLLKQSTMSTGNVQQTIDAAD
YRVQGHYQTPVIQHCHMESVTSLAWMEDDARITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGKMG
VNHDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALDLDPVEIRLRNAAREGDANPLTGKRIYSAGLPECL
EKGREIFEWEKRRAECQNLQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDITPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIALVKRPEEPLLSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacaggtgaatcatgtatgcgcgtagatgccattgct
aaggttaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttacgcg
aaatatgtacgtagtcctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
agaagtctgcctggcgtactggctatttttacctgggaagatgtaccggatatcccattc
gccacggcagggcatgcctggacacttgacgaaaataaacgcgataccgccgatcgcgca
ctgttaactcgccatgttcgccatcatggtgatgccgttgccatcgtcgtggcccgagat
gaactcacagcagaaaaagcagcgcaattagtcagtattgagtggcaagaattacccgtt
atcaccacaccagaagcggcacttgcagaagacgccgctaaaattcacagccgcggtaat
ttgcttaagcaaagcacgatgtctacgggcaatgtccagcaaacaatcgatgccgccgat
taccgggtgcagggacactatcagacccccgtcattcaacattgccacatggaaagtgtg
acatcgctggcgtggatggaggatgacgcgcgaattaccatcgtctccagtacgcagatc
ccgcacattgttcgccgcgttgtcggtcaggcgttggatattccctggtcatgcgtgcgg
gtaatcaaaccgtttgtcggtggaggttttggtaataaacaagatgtgctggaggagcca
atggcggcattcctgaccagcaagctcggcggtattccggtgaaagtttcccttagtcgt
gaagagtgtttcctggcgacccgtacccgccacgcttttaccattgacgggaaaatgggg
gttaaccacgatggtacgctgaaaggctatagtctggatgttctgtccaacacgggtgct
tatgcctctcacggccattccattgcttccgcaggtggtaacaaagtggcgtatctttat
cctcgttgcgcctacgcttacagctcaaagacctgctataccaatctaccctcggctggc
gcaatgcgtggttatggcgcaccgcaagtcgtttttgccgtcgaatcaatgctggatgac
gccgctaccgcgttagatcttgacccggtagaaattcgtttacgtaatgccgcccgtgaa
ggcgatgcaaatccactcactggaaaacgcatttacagtgccggattacctgagtgtctg
gaaaaagggcgggaaatctttgaatgggaaaaacgacgtgcagagtgccagaacctgcaa
ggcaatttgcgccgcggcgttggcgttgcctgttttagctacacctctaacacctggcct
gttggtgtagaaatcgcgggcgcacgcttgttgatgaatcaggatggaactatcaacgtg
caaagcggcgctacggaaatcggtcagggtgccgacactgtgttctcgcaaatggtggct
gaaaccgtgggggttccggtcagcgatgtccgcgtgatttcgacacaagataccgatatt
acgccattcgatccaggtgcgtttgcttcacgccagagctatgttgccgcgcctgcgtta
cgcagtgctgcattgctattgaaagagaaaatcatcgctcatgccgctgtaatgctacat
cagtcagcgatgaatctgacactgataaaaggccatatcgcgctggttaaaaggccggaa
gagccattgctgtcgttaaaagatctggcgatggatgctttttatcatcctgagcgcggc
gggcaactttctgctgaaagctcgatcaaaaccaccactaacccaccggcatttggctgt
acttttgttgatctgacggttgatattgcgctgtgtaaagtgaccatcaatcgcatcctc
aacgtccatgattcgggccatattcttaacccgctgctggctgaaggtcaggttcacggc
ggaatgggaatgggcattggctgggcgttatttgaagagatgattatcgatgcgaaaagt
ggtgtggtacgtaaccccaatctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgtttgtcgaaatcaatgaaccacaatccgcatacggacataagtca
ctgggtgagccgccaataattcctgtcgccgctgcgattcgtaacgcggtgaaaatggct
accggtgttgcaatcaataccctgccgctgacgccaaaacggttatacgaagagttccat
ctggcaggattgatttga

DBGET integrated database retrieval system