KEGG   Euzebyella marina: D1013_05135Help
Entry
D1013_05135       CDS       T05677                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
emar  Euzebyella marina
Pathway
emar00051  Fructose and mannose metabolism
emar00520  Amino sugar and nucleotide sugar metabolism
emar01100  Metabolic pathways
emar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:emar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    D1013_05135
   00520 Amino sugar and nucleotide sugar metabolism
    D1013_05135
Enzymes [BR:emar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     D1013_05135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AYN69616
UniProt: A0A3G2LBH5
Position
1279557..1280636
Genome map
AA seq 359 aa AA seqDB search
MNKNYYAVLMAGGVGSRFWPISTSSYPKQFHDMLGTGDTLIQKTFKRLNKFVPTENILIL
TNESYNDLVLEQLPMVKQDQVVLEPAMRNTAPCILYAALKIQKMNPDGVMIVAPSDHWIE
DEEAFAEDVTTCFKKCEEEEVLCTLGIKPSFPNTGFGYIEFDKNSGAGLKKVNQFREKPD
YETAKEFLAQGNFLWNAGIFMWSVKTIVNAFKNYQPKQFELFEAGNSCYNTVDEKEFIKE
NYPKAENISIDYAILENSKSIYVLPATFDWNDLGTWGSLYDKLDKDESQNAVVNSKVISD
EASGNMIRSPKGKVVVVDGLKDYIIVDKEEVLLIYPKAKEQDIKKVLAKVKDTFGDTYA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaattattatgccgtactcatggccggtggtgttggatctcgtttttggcct
ataagtacatcatcttatccaaaacagtttcatgatatgctgggtaccggcgatacgctt
atacagaaaacctttaagaggttgaacaagtttgtacccacagagaacattcttattttg
acaaacgagagttataatgatctggtcttagagcagttgccaatggtaaagcaagaccaa
gtagttttagagccggcaatgcgaaataccgcaccttgtattttatacgctgctttgaaa
attcagaaaatgaaccccgacggggtaatgattgtggcgccaagcgatcattggattgaa
gacgaagaagcttttgctgaagatgtcaccacttgctttaaaaagtgtgaagaagaagag
gttctttgtacattgggtataaaaccatcttttccaaacacgggttttgggtatatagaa
ttcgataagaatagcggtgcaggattgaaaaaagtgaatcaatttcgtgaaaaacctgat
tacgaaacggcaaaggaatttttggctcaaggaaattttttatggaatgcaggtattttt
atgtggagtgtgaagaccatagtgaacgcctttaaaaattaccaaccgaaacagtttgag
ttatttgaggccggtaattcttgctataacacggttgatgaaaaagagtttatcaaagag
aactatccaaaagcagaaaatatttctattgattatgccattttagagaactcgaaatca
atttatgtgctgcccgccacgtttgattggaacgatttaggcacttggggatccctttat
gataagttagataaagatgagtcgcaaaatgccgtggtcaatagtaaggtcatttcagat
gaggcttcgggcaatatgatcagatcgcctaaaggcaaagtagttgttgtcgacggtctt
aaagattatatcatagttgataaagaagaagtattgttgatataccctaaagcaaaagaa
caagatattaaaaaggtactggccaaggttaaagatacatttggtgacacctatgcatag

DBGET integrated database retrieval system