KEGG   Elizabethkingia meningoseptica: BBD33_12290Help
Entry
BBD33_12290       CDS       T04744                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
emg  Elizabethkingia meningoseptica
Pathway
emg00010  Glycolysis / Gluconeogenesis
emg00053  Ascorbate and aldarate metabolism
emg00071  Fatty acid degradation
emg00280  Valine, leucine and isoleucine degradation
emg00310  Lysine degradation
emg00330  Arginine and proline metabolism
emg00340  Histidine metabolism
emg00380  Tryptophan metabolism
emg00410  beta-Alanine metabolism
emg00561  Glycerolipid metabolism
emg00620  Pyruvate metabolism
emg00625  Chloroalkane and chloroalkene degradation
emg01100  Metabolic pathways
emg01110  Biosynthesis of secondary metabolites
emg01120  Microbial metabolism in diverse environments
emg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:emg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BBD33_12290
   00053 Ascorbate and aldarate metabolism
    BBD33_12290
   00620 Pyruvate metabolism
    BBD33_12290
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BBD33_12290
   00561 Glycerolipid metabolism
    BBD33_12290
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBD33_12290
   00310 Lysine degradation
    BBD33_12290
   00330 Arginine and proline metabolism
    BBD33_12290
   00340 Histidine metabolism
    BBD33_12290
   00380 Tryptophan metabolism
    BBD33_12290
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BBD33_12290
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BBD33_12290
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BBD33_12290
Enzymes [BR:emg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BBD33_12290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AQX05979
Position
complement(2691212..2692762)
Genome map
AA seq 516 aa AA seqDB search
MAKTHQSFKIEKTLERLGISKDNKGASSGTKFFATGKSIDSYSPVDGKLIASVKTASEKD
YEKVIKLAQKAASEFRLIPAPKRGEIIRQFGLKLREYKDDLGKLVSYEMGKSLQEGWGEV
QEMIDICDFAVGLSRQLHGFTMHSERPGHRMYEQYHPLGVVGIISAFNFPVAVWSWNTAL
ALICGNVIIWKPSEKTPLCGIACQNIMAEVLKENNLPEGISNLLVSDHVVGQKIVESKDV
SLVSFTGSTAVGRQVASKVAERFGKSILELGGNNAIIITENADLEISIIGAVFGAVGTAG
QRCTSTRRLIIHESVYDKVKSKLVKAYGQLKIGDPLNVENHVGPLIDELAVKQYEAAIAK
CKKEGGKFAVEGGVLKGKEYASGCYVKPCIAEVKNSFEIVQHETFAPILYIMKYKTLEEA
IALQNDVPQGLSSAIMTQNLREAELFLSHAGSDCGIANVNIGTSGAEIGGAFGGEKETGG
GRESGSDAWKYYMRRQTNTINYSKELPLAQGIKFNI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggctaagactcatcaaagttttaagatcgaaaaaacactcgagcgccttggaatttcc
aaagacaataaaggcgcttcttccggcactaaattttttgcaaccggtaaatcaattgat
tcctattctcctgtagacggtaaactgattgccagtgttaaaacggcatcggagaaggat
tatgaaaaagttataaagctcgctcagaaagcggcatcagaatttagattaatacctgca
cctaaaagaggcgagatcatcagacaattcggattaaagcttcgtgaatataaagacgac
ttagggaaacttgtttcttacgaaatgggtaaatccttgcaggaaggctggggtgaagtt
caggaaatgattgacatttgcgatttcgctgtaggactttccaggcaattacacggtttt
accatgcattccgagcgtccgggacacagaatgtacgaacaatatcatccgcttggtgtt
gtaggcattatatcggcttttaactttccggtagccgtatggagctggaatacagcgctg
gcacttatttgcggaaatgttattatctggaaaccttctgaaaaaacacctttatgtggt
attgcctgtcagaatattatggcagaagttctgaaagagaataatctgccggaaggaatt
tccaatcttctggtaagtgatcatgttgtagggcagaaaatagtggagagtaaagatgtt
tcacttgtttcatttaccggttctacggctgtcggcagacaggttgcttctaaagttgct
gaaaggttcggaaaatctattctggaattgggaggaaacaatgcgatcattattacggaa
aatgcagatcttgaaatatctattattggtgctgtatttggtgctgtaggcacagcagga
cagcgatgtacttctaccagaaggttaatcattcatgaaagtgtatatgacaaggttaaa
agtaaacttgtaaaagcttatggacagcttaaaataggtgatcctttgaatgttgaaaat
catgtaggtccgttaatagacgaacttgctgtgaagcagtatgaagctgctattgcaaag
tgcaaaaaagaaggtgggaagtttgcagtggaaggtggcgttcttaaaggtaaagagtat
gcttcaggatgctatgtgaaaccatgtattgcagaagttaaaaactcttttgagattgta
cagcatgaaacttttgcgccaattctgtatatcatgaaatacaaaacgcttgaagaggct
attgctttacaaaatgatgttccgcagggactttcttcagcgattatgacacaaaacctg
agagaggctgaattattcctttcacatgccggttccgattgcggtattgccaatgtaaat
attggaacttccggagctgaaatcggaggggcttttggtggtgaaaaagaaaccggcggc
ggccgtgaatctggttccgatgcatggaaatattacatgagaagacaaaccaataccatt
aattacagtaaagaattgcctttagcacaaggaattaaattcaatatttaa

DBGET integrated database retrieval system