KEGG   Elizabethkingia meningoseptica: BBD33_12970Help
Entry
BBD33_12970       CDS       T04744                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
emg  Elizabethkingia meningoseptica
Brite
KEGG Orthology (KO) [BR:emg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BBD33_12970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AQX06106
UniProt: A0A1V3U0M8
Position
complement(2852240..2852629)
Genome map
AA seq 129 aa AA seqDB search
MMYSAITHSIQIIVEPFYDVKNSSPIQERYIFTYHITIKNNGNVPIKLLKRKWQIYDVGF
GVREVSGDGVIGMMPEIYPGEEFNYFSNVSLRAGVGAMQGNYLLMNLDTKDTFEVEIPKF
SLITEVVYN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtactcagcaattacccacagcattcagattattgttgaacccttttacgacgtt
aaaaatagttcaccaatacaggagcgttacatttttacgtatcacattacgattaaaaat
aacggcaacgtgcctattaagcttctgaaaagaaaatggcagatttatgatgtcggtttc
ggcgtcagggaagtctccggagacggcgtaataggaatgatgcctgagatatatcccgga
gaggaattcaattatttctccaatgtatcattgcgggccggagtaggagcgatgcaggga
aattacctgttgatgaatctggatacaaaagatacattcgaggttgaaattcctaagttt
tcattgataacggaagtcgtatataactaa

DBGET integrated database retrieval system