KEGG   Elusimicrobium minutum: Emin_0039Help
Entry
Emin_0039         CDS       T00741                                 

Definition
(GenBank) Exonuclease VII small subunit
  KO
K03602  exodeoxyribonuclease VII small subunit [EC:3.1.11.6]
Organism
emi  Elusimicrobium minutum
Pathway
emi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:emi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    Emin_0039
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:emi03400]
    Emin_0039
Enzymes [BR:emi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.6  exodeoxyribonuclease VII
     Emin_0039
DNA repair and recombination proteins [BR:emi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA exonucleases
     Emin_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_VII_S KxDL DUF4362
Motif
Other DBs
NCBI-ProteinID: ACC97607
UniProt: B2KAR1
Position
complement(41793..42020)
Genome map
AA seq 75 aa AA seqDB search
MKEQSFEANLKKLEKIVAQLEDEKTDLDKSAELFEEGSALAAELSAKLKTIKFKVSEIKE
KQGDLFTEEINNDDE
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaatcatttgaagctaaccttaaaaagttagaaaaaatagtagctcaatta
gaagacgaaaaaactgatttagacaaatcagccgagctttttgaggaaggctccgccttg
gcggcggaactgtcggccaaattgaaaactattaaatttaaagtaagcgaaataaaagaa
aaacagggcgacctttttacggaagaaataaataatgatgacgagtaa

DBGET integrated database retrieval system