KEGG   Elusimicrobium minutum: Emin_0634Help
Entry
Emin_0634         CDS       T00741                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
emi  Elusimicrobium minutum
Pathway
emi00790  Folate biosynthesis
emi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Emin_0634
Enzymes [BR:emi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Emin_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACC98189
UniProt: B2KC62
Position
complement(690823..691341)
Genome map
AA seq 172 aa AA seqDB search
MLAYIGDNPNREGLQETPHRIVKSWEKIFGGYKQKPESVLKTFVEGSCDEMVILKDIEFY
STCEHHFQPFFGTISIGYLPNKRVLGVSKLARLVEVFSRRLQIQEKLSADIADSLMQHLN
PLGVMVVCKARHMCVCSRGVEKHNAVMITSAIRGVFKKPEVRGEFLDFIQAN
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcctacatcggcgacaatcccaaccgtgaaggtttgcaggaaaccccgcacagg
atagtaaaaagctgggaaaaaatttttggcgggtataaacaaaagccagaaagcgttcta
aaaacttttgtggaaggctcctgcgatgaaatggttattttaaaagatattgaattttat
tctacctgcgagcatcattttcagccgtttttcggcacgataagcataggttatcttccc
aacaaaagagttttgggcgtatcaaaactggcaaggcttgttgaagtattttcccgcaga
ttacagatacaggaaaagctttccgccgatatagcggactccttaatgcagcacttaaat
cccttaggagtaatggttgtttgtaaagcaagacatatgtgcgtttgcagcagaggggtt
gaaaaacataacgccgttatgataaccagcgctataagaggcgtgtttaaaaaacctgaa
gtaaggggagagtttttggactttatacaagccaattaa

DBGET integrated database retrieval system