KEGG   Elusimicrobium minutum: Emin_1013Help
Entry
Emin_1013         CDS       T00741                                 

Definition
(GenBank) Putative lactate dehydrogenase
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Organism
emi  Elusimicrobium minutum
Pathway
emi00620  Pyruvate metabolism
emi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:emi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Emin_1013
Enzymes [BR:emi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     Emin_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 AlaDh_PNT_C F420_oxidored XdhC_C
Motif
Other DBs
NCBI-ProteinID: ACC98566
UniProt: B2KDH0
Position
1105293..1106309
Genome map
AA seq 338 aa AA seqDB search
MKIVFFDLDEIKPDKEILDGSNVNVEVIELSKNVFETDENDNVFDAEGISLFSTSRKIGS
DILSKFPNLKFISVRSTGFDAIDTTYCKEKSIRVFNVPRYGETTVAEYTIGMIFALTRNI
VRANNDMKDRNQLDIKSYSSRDLEAWTLGVLGAGAIGRSVINKAQCLGMNVIAYDPYPSK
DFPNIKYVSLEELIKNSDIISLHVPSTKENYHMIGEENFKKMKKGVYIINTARGDLIDNK
ALYGALLSGHVAGTALDVLEEEGLMVGDDTLGMLAQRTKEELFTYSINTKLMNLDNVIVT
PHIAFDTLDARKRIMTQTCKNIAGYYNAELEKPSEPKI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagtgttttttgatttagacgaaataaagcccgataaagaaatattagacggc
tcgaatgttaacgttgaggttattgagctttccaaaaacgtgtttgaaacagatgaaaac
gacaacgtgtttgacgcagaaggaatttctttattttcaacgtcaagaaaaataggttcg
gatatattatcaaaatttcctaatttgaaatttatttccgtacgctcaacaggttttgac
gccattgacaccacttactgtaaagaaaaatctataagagtgtttaacgtgcccagatac
ggcgaaacaaccgttgctgaatatactatcggcatgattttcgcgcttacaagaaatata
gtacgcgcgaataatgacatgaaggacagaaaccagcttgatatcaaatcctacagcagc
agggatttggaagcttggactttaggcgttttaggcgcgggcgccattggcagaagcgtt
attaataaagcccaatgccttggcatgaatgttatagcttatgacccgtacccttccaaa
gacttcccgaacataaaatacgtaagtttggaagagcttattaaaaactccgacataatt
tcgcttcacgttccttccaccaaagaaaactaccatatgataggcgaagagaattttaaa
aaaatgaaaaaaggcgtttatattatcaacaccgcgcgcggcgatttgattgataataaa
gccctttacggggcgctcctttccggtcatgtggcgggaacggcgcttgacgtgcttgag
gaagaaggtcttatggttggcgatgataccttaggcatgcttgcccaaagaacaaaagaa
gagctgtttacctattcaataaatacaaaacttatgaatttggataatgttatagtaacg
ccgcatatagcgtttgacactttagacgcgagaaaaagaattatgacgcaaacttgcaaa
aacatagcgggctattataacgctgagctagaaaaacccagtgaacctaagatttaa

DBGET integrated database retrieval system