KEGG   Elusimicrobium minutum: Emin_1220Help
Entry
Emin_1220         CDS       T00741                                 

Definition
(GenBank) Putative dihydroneopterin monophosphate dephosphorylase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
emi  Elusimicrobium minutum
Pathway
emi00730  Thiamine metabolism
emi00790  Folate biosynthesis
emi01100  Metabolic pathways
emi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:emi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Emin_1220
   00790 Folate biosynthesis
    Emin_1220
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Emin_1220
Enzymes [BR:emi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Emin_1220
Exosome [BR:emi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Emin_1220
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:emi00537]
 Enzymes
  Emin_1220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Sulfatase RTX_C
Motif
Other DBs
NCBI-ProteinID: ACC98770
UniProt: B2KE24
Position
complement(1319979..1321343)
Genome map
AA seq 454 aa AA seqDB search
MKKIYTVAILMFCAVFIFAQNPKNVKNIILVIGDGFGPQEVGLMAQYARYAPSSPYADRQ
SNLEKFFNKSNVGLALTNPKNFLVTDSACSGTQIATGHFSSPESVGVDYQGNAQKTILEY
AKEAGKSTGLITTVYLQDATPAVFAAHQPNRNKKAEIASDMVNTGVDVMLGGGRKYFAPI
AGQIEALGYKIINSRVELENIELEKGKKLLGVFAENEIPFVIMNDISAPSLTQMTEKALD
ILSQNEKGFFIMVEAGRIDWALHANDAASSLYEILELDETLGYLLKWAEKRNDTLVILTA
DHETGGFGFNYHKLKGERLTKAKESGEVLYGSGTDYVSPEVFEKIMKQKTLLYNVEKEFN
ALPKRKQKSKTLGKMLSDVVGYQLAGEIYKDCKTFSCALKNYNNSLGIVWSTGAHTATPV
EVAAWGPTQANYSGLYHTTDLNKKMRKSFGFEVK
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatacactgttgcaatacttatgttttgcgctgtttttatctttgcgcaa
aatcctaaaaatgtaaaaaacattattttagttattggcgacggctttggcccccaggaa
gtaggtttaatggcgcagtacgcgcgttacgctccgtcctcgccttatgcggacaggcag
tcaaaccttgaaaagttttttaataaatctaatgtaggcttagcgcttaccaatccgaaa
aattttttagtaactgattccgcctgttccggcactcaaatcgcgacaggacatttttct
tctcctgaatcagtgggtgttgactaccagggtaatgcgcaaaaaacaattttggaatac
gctaaagaagcgggtaaaagcacaggtcttataaccacagtatatttacaagacgcaacg
cccgctgtttttgccgcgcaccagcccaacagaaataaaaaagcggaaatagcttccgac
atggtaaatacgggcgtggatgttatgcttggaggcggaaggaaatattttgcgccgata
gcgggtcaaattgaagctttaggctataaaattataaacagcagagttgaattagaaaac
attgaacttgaaaaaggcaaaaaacttttaggcgtatttgctgaaaatgaaatccctttt
gtgattatgaatgatatttccgcaccttctcttactcaaatgactgaaaaagcgcttgat
attttaagccaaaatgaaaaaggtttttttattatggttgaagcgggcaggattgactgg
gctcttcacgctaatgacgcggcttcttctttgtatgaaattttagagttagacgaaact
ttaggatatctgttaaaatgggctgaaaaaagaaatgatactttggtaatattaacggcc
gaccatgaaaccggcggttttggttttaattaccataaattaaaaggtgaaagacttaca
aaagcaaaagaaagcggcgaagtgctttacggctcgggcactgattatgtaagccccgag
gtttttgaaaaaataatgaaacaaaaaacattgctttataatgttgaaaaagagtttaac
gctttacccaaaagaaaacaaaaaagcaaaactttgggcaaaatgttaagcgatgttgta
ggctaccaattagccggggaaatttacaaagactgtaaaacttttagctgcgctttaaaa
aattacaacaattctttaggtatagtttggtctaccggcgcgcatacggctacgcccgtt
gaagtcgccgcgtgggggcctacgcaagccaattacagcggcctttaccatactacggat
ttaaataagaaaatgcgtaagagttttggttttgaggttaaataa

DBGET integrated database retrieval system