KEGG   Elizabethkingia anophelis FMS-007: M876_06475
Entry
M876_06475        CDS       T03946                                 

Definition
(GenBank) flavastacin
  KO
K20138  flavastacin [EC:3.4.24.76]
Organism
emn  Elizabethkingia anophelis FMS-007
Brite
KEGG Orthology (KO) [BR:emn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:emn01002]
    M876_06475
Enzymes [BR:emn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.76  flavastacin
     M876_06475
Peptidases and inhibitors [BR:emn01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   M876_06475
SSDB
Motif
Pfam: Astacin RicinB_lectin_2 Ricin_B_lectin Peptidase_M10 DUF3810 Reprolysin_5 Reprolysin_4 NUC153
Other DBs
NCBI-ProteinID: AKH94209
Position
1374915..1376246
AA seq 443 aa
MTRKLLILSGCLLLALNSCKSDMETTPASSVDHTTTQLNGTTIHKLLINGAYTYVNEVNG
EYFYADDITITAEQFNQLKRMANPDISTVERSTIVSSFIKTWPNATVYYTLPSQGSLSTQ
AYNTFLTNINKAFDMISSKTNVKFIQRTNQTEYITFTYSTGNSSPLGWVKNRVNGIKIYN
TTYPAIIAHEIMHSMGIMHEQCRPDRDQYIIVDTNRAQEGSRHNFNLYNDYAGHGEFDFG
SVMMYKSTDFAIDPNLPVMTKLDGSTFGKQRDGLSAGDYAGINHLYGPVNSTSATNGTYT
LTTSLAGDKNVDITGSSTADGTDVILYSATTGNNQKFIFRKSDHGYFTIKSILDSTKVLT
VRNNGTANGTAVELRTNADTDSQKWLLFNLGNEGFGFAPKNAPSLRLEVKDGLTTNLTPI
VIGSTDQTLQPYTKQRFKLTKVN
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgacacgtaaactattaatcttatcaggctgcctgcttttggctctgaattcttgtaag
tcggatatggaaactactcctgcaagttcggttgatcatacaacaacccagctgaacgga
acaaccattcacaaattattaattaacggagcctatacctatgtaaatgaagtcaatggc
gagtacttttacgctgatgatattacaattacagcggagcagtttaaccagctgaaaaga
atggccaacccggatatatctacagttgagcgtagtacaattgtaagttcttttatcaaa
acatggccaaatgccacagtttattataccttaccaagccagggaagtttaagtactcag
gcttacaatacattccttacaaatattaataaggcgtttgatatgatctcttcaaaaacc
aatgttaagttcattcagcgtaccaatcagacagaatatattacatttacttactctaca
ggaaacagctccccactgggttgggtaaaaaacagagtaaatggtattaaaatatacaat
acaacttatcctgccattattgcgcatgagataatgcactcaatggggattatgcacgag
cagtgccgtccggacagagatcagtatattatagtagataccaacagagcgcaggaaggt
tcccgccacaatttcaatctttataacgattacgcaggacacggagagtttgactttggt
tcggtgatgatgtataaatctacagattttgcaatagatcctaatctgcctgtgatgaca
aaactggatggttctacatttggtaagcaaagagatggcctgtctgctggtgattatgca
ggaatcaatcatttgtatggacctgtaaactcaacatctgctactaacggtacgtataca
ctaacaacttctttagcaggtgacaaaaatgttgatattaccggaagttcaacagctgat
ggtacggatgtaatcctttattctgcaacgacaggaaacaatcagaaatttatcttccgt
aaatccgatcatggttattttactattaagtcgatactggattctacaaaagtattaacg
gtaagaaataacggaacagcaaacggaacagcggtagagctaagaaccaatgcggatacg
gatagtcagaaatggttgttatttaatttaggaaatgaaggttttggctttgctcctaaa
aatgcaccatctttaagattagaagtaaaagatggtctgacaaccaatcttacacctatt
gttattggcagtacagatcagacacttcagccttacacaaaacagcgctttaagcttaca
aaagtaaactaa

DBGET integrated database retrieval system