KEGG   Elizabethkingia anophelis FMS-007: M876_13445Help
Entry
M876_13445        CDS       T03946                                 

Definition
(GenBank) siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
emn  Elizabethkingia anophelis FMS-007
Pathway
emn00860  Porphyrin and chlorophyll metabolism
emn01100  Metabolic pathways
emn01110  Biosynthesis of secondary metabolites
emn01120  Microbial metabolism in diverse environments
Module
emn_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:emn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    M876_13445
Enzymes [BR:emn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     M876_13445
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     M876_13445
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     M876_13445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase PARP_regulatory
Motif
Other DBs
NCBI-ProteinID: AKH95572
Position
complement(2862418..2863263)
Genome map
AA seq 281 aa AA seqDB search
MKITNKTPKVYLIGAGPGDPDLITVKAIRAITEADVILCDRLVSPEIVDNYVGKETEIVY
VGKECSKKASTPQSSINELMIEYALQNKTVARLKGGDVSIFSNILDELQVLKENKIAYEI
IPGVTAALGAAAYAGMPLTARGYATSVRFLTYYKSEIMTEDYWKEIAETNDTLVFYMSVG
NLTNLVDKFKEYDVSSEKKIAVIEQATTPFQKVYTSSFEDFAQKLGHKLFASPSLVVIGK
IVNLHEEFSWLQNTDSEGLYFKSITNGSLLPKTQNFFEYVV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactaataaaacaccaaaggtatatcttatcggtgcagggcctggtgatcct
gatctgatcacagtaaaggctatccgagccattacagaagcagatgtaatcttatgcgac
aggcttgttagtcctgaaattgtggataactatgtaggcaaagaaacagagatagtatat
gtaggtaaagaatgcagcaaaaaagcatccacaccacagtcttctattaatgagctaatg
atagaatacgcacttcagaataaaacggttgcaagactaaagggtggggatgtatctata
ttttccaatattctggatgagttacaggtactgaaagagaataagatcgcgtatgaaatt
attcccggggtaactgcggctcttggcgcggctgcttatgcaggaatgcccttgacagca
agaggatatgctacgtcagttagatttcttacctattataagtccgaaataatgactgaa
gactattggaaagaaatagcggaaaccaatgatacactggtgttttatatgtctgtagga
aatcttaccaatctggtggataaatttaaagaatatgatgtgtcttcggaaaagaaaatt
gccgtaatagaacaggcaaccacaccttttcagaaggtatatacttcttcttttgaagat
tttgcccaaaaattggggcataaactatttgcatcaccatctctggtggttatcggcaaa
atagtaaacctgcatgaagaattctcctggctgcagaatacagacagtgaaggattgtat
ttcaaatcgataaccaacggaagtctgcttccaaaaactcaaaacttttttgaatatgtt
gtctga

DBGET integrated database retrieval system