KEGG   Ehrlichia muris: EMUR_00270Help
Entry
EMUR_00270        CDS       T02967                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
emr  Ehrlichia muris
Pathway
emr00010  Glycolysis / Gluconeogenesis
emr00020  Citrate cycle (TCA cycle)
emr00620  Pyruvate metabolism
emr01100  Metabolic pathways
emr01110  Biosynthesis of secondary metabolites
emr01120  Microbial metabolism in diverse environments
emr01130  Biosynthesis of antibiotics
emr01200  Carbon metabolism
Module
emr_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:emr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EMUR_00270
   00020 Citrate cycle (TCA cycle)
    EMUR_00270
   00620 Pyruvate metabolism
    EMUR_00270
Enzymes [BR:emr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EMUR_00270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AHC38911
UniProt: V9R7W0
Position
63530..64795
Genome map
AA seq 421 aa AA seqDB search
MPIEVLMPALSPTMKSGTIRKWYKSEGDVVKSGDIIADIETDKAVMEFEYTDEDGIMGKV
FFEEGSKNVQVNQLIALIAVDEQDLVEIHSYKKSNNVPKDGSVTSQINQQAVSSDNVPKD
GSVVSQINQQVNTAMLNSPSNSCERIKISPLAKKIASDLCVDINLVKGTGPYGRIIKADI
LDIVNQKGNVSNSLGGSSFAEISSMRRVIAERLVHSKQTIPHFYISIDCLVDDLLKLRLE
INAENLDNKVTVNDFIIKAVAMSIKKFPEINVSWSDDKIVVFHSIDISVAVSIDNGLITP
IVFNADKKSLLEISSEVKVLATKAKSGKLKPEEFQGGGFTVSNLGMFGIKEFYAIVNPPQ
SCIMSVGCSEKKAIVVGEQVCISNVMTITLSVDHRVIDGVLAARFLNCFKSYLEKPFLML
I
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccaatagaagtattgatgcctgctctttctccaaccatgaaaagtgggactataaga
aaatggtataagtcagaaggtgatgtagtcaagtcaggtgatataatagctgatatagaa
actgataaagctgttatggaatttgagtatacagatgaagatggtatcatgggcaaagtt
ttctttgaagaaggaagcaagaatgtacaagtgaaccaattgatagcattaattgctgta
gatgaacaagatctagttgaaattcattcatataagaagagtaataatgttcctaaagat
ggatcggttacatcgcagattaatcaacaggctgtaagtagtgataatgttcctaaagat
ggatcagttgtatcgcagattaatcaacaggtaaatactgcgatgttaaatagtccttct
aattcatgtgaaagaattaaaattagtcctttagccaagaagattgcttccgacctgtgt
gttgatatcaatttagtaaaaggaacgggtccttacggaagaattataaaagctgatata
ttagatattgtaaatcaaaagggtaatgtttctaattctttgggaggaagttcttttgct
gaaattagtagcatgcgtagagtaatagcagaacgtttagtacattctaagcaaacgatt
cctcatttttatatttcgatagattgtttggtggatgatctattaaaactaagattagaa
attaatgctgaaaatcttgataataaagttacagtaaatgatttcattattaaagctgtt
gctatgagcattaagaaatttcctgaaattaatgtatcttggtctgatgataaaatagtt
gtatttcatagtattgatatttcagttgctgtatctattgataatggacttattacccca
attgttttcaatgcagataaaaagtctttgttagaaatatcaagtgaagttaaagtatta
gctactaaagctaagtctggcaagttgaaaccagaggagttccaaggtggaggttttact
gtttctaatcttggtatgtttggtattaaagaattttatgcaattgttaatcctccacaa
tcctgtataatgtctgttgggtgttctgagaaaaaagcaatagttgttggtgaacaagtg
tgtatttcaaatgttatgacaataacattgtctgtagatcatagagtgattgatggtgtg
ttagcagcaagatttttaaattgctttaagtcttatttagagaaaccgtttttaatgtta
atatag

DBGET integrated database retrieval system