KEGG   Ehrlichia muris: EMUR_01580Help
Entry
EMUR_01580        CDS       T02967                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
emr  Ehrlichia muris
Pathway
emr00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:emr00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EMUR_01580
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:emr01007]
    EMUR_01580
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:emr03016]
    EMUR_01580
Enzymes [BR:emr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     EMUR_01580
Amino acid related enzymes [BR:emr01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   EMUR_01580
Transfer RNA biogenesis [BR:emr03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    EMUR_01580
 Prokaryotic Type
    EMUR_01580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1f tRNA-synt_1 tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AHC39127
UniProt: V9R5T7
Position
406390..407769
Genome map
AA seq 459 aa AA seqDB search
MIIYNTLTGIKEPFIPLSSDNVKVYVCGPTVYDFAHIGNSRSIIIYDVLFRLLKLLYPKV
TYVRNITDVDDKIINVAQSSKQNIYDVTSTYIRAFHEDMKMLNCLDPTYEPRATDSVDIM
INLIQKLIDLGHAYVYNGSVFFNIKSYPSYGKLSRRNISELIYGSRVDVELGKKHPGDFV
LWKPATEIDKQLMSCWSSPWGLGRPGWHIECSAMSYCYLGENFDIHGGGADLQFPHHENE
IAQNCCAFPGSQYAKYWVHNGFLTVNGEKMSKSLGNVLTVRQLLDSGIKGELIRYVLLSA
HYRKPLDWSSKIVANAQESLNRMYTALSSIDADLSLDSGVELSNSVIDCLKDDINTPKAI
SILHEMVTKINKTSDIMKKVCLTKTLIKTANFLGILQHSWQDWFKIDNNDKEISQLIDER
KKARASNDFKKADDIRQLLLDRGIVLSDNRDGTTHWYKK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgatcatatataatactttaactggcattaaggaaccttttattcctttgagtagtgat
aatgtgaaggtttatgtttgtggtcctacagtctatgattttgcgcatattgggaattct
aggtcaatcattatatatgatgtgctgtttagattgttaaaattgctatatcctaaagtg
acttatgtaagaaacattactgatgttgacgataagattattaatgttgcacaaagtagt
aagcagaatatatatgatgttacttcaacttatataagagcatttcatgaagatatgaaa
atgctgaattgtttagacccaacttatgagccaagagcaactgatagtgtagatattatg
atcaatttgatacagaagttaatagatctgggtcatgcgtatgtgtataatggtagtgtg
ttttttaatatcaaatcttatccttcctatggtaagttatctcggcgtaatatctcagaa
cttatttatggtagtagggtagatgtggaattgggtaaaaaacatccaggggattttgtt
ttatggaaacctgctactgaaatagataagcaattaatgagttgttggtcaagtccttgg
ggattagggaggccaggctggcatatagaatgttcagctatgagttattgttatttaggt
gaaaattttgatattcatggtggtggagcagatttacagtttcctcatcatgaaaatgaa
atagcacaaaattgttgtgcttttcctggtagccaatatgctaaatattgggtgcacaat
gggtttcttactgttaatggtgagaaaatgagtaaatctttaggtaatgttttaacagtg
aggcagttattggatagtggaatcaaaggtgaattgataagatatgtattgttaagtgca
cattataggaaacctttagattggagtagtaaaatagtagctaatgctcaagagtcgctt
aatcgtatgtatactgctttaagttcaatagatgctgatttatcattggatagtggagtt
gaattatctaatagtgttattgattgtttaaaagatgatattaatactccaaaggctatt
tcaatattgcatgagatggttacaaagattaataaaacatctgatataatgaaaaaggta
tgtttaacaaaaactcttattaaaactgcaaattttttgggtattttacagcattcttgg
caagattggtttaaaattgataataatgataaagaaatcagtcaattaatagatgaaaga
aaaaaagcaagagcaagtaatgattttaaaaaggcagatgatatacgtcagcttttgtta
gatcgaggaatagttctgtctgataatagagatggaactacacattggtataagaagtaa

DBGET integrated database retrieval system