KEGG   Enterococcus mundtii: EMQU_1045Help
Entry
EMQU_1045         CDS       T02931                                 

Definition
(GenBank) acetyl-CoA acetyltransferase/hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
emu  Enterococcus mundtii
Pathway
emu00071  Fatty acid degradation
emu00072  Synthesis and degradation of ketone bodies
emu00280  Valine, leucine and isoleucine degradation
emu00310  Lysine degradation
emu00362  Benzoate degradation
emu00380  Tryptophan metabolism
emu00620  Pyruvate metabolism
emu00630  Glyoxylate and dicarboxylate metabolism
emu00640  Propanoate metabolism
emu00650  Butanoate metabolism
emu00900  Terpenoid backbone biosynthesis
emu01100  Metabolic pathways
emu01110  Biosynthesis of secondary metabolites
emu01120  Microbial metabolism in diverse environments
emu01130  Biosynthesis of antibiotics
emu01200  Carbon metabolism
emu01212  Fatty acid metabolism
emu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:emu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EMQU_1045
   00630 Glyoxylate and dicarboxylate metabolism
    EMQU_1045
   00640 Propanoate metabolism
    EMQU_1045
   00650 Butanoate metabolism
    EMQU_1045
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EMQU_1045
   00072 Synthesis and degradation of ketone bodies
    EMQU_1045
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EMQU_1045
   00310 Lysine degradation
    EMQU_1045
   00380 Tryptophan metabolism
    EMQU_1045
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EMQU_1045
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EMQU_1045
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EMQU_1045
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:emu04147]
    EMQU_1045
Enzymes [BR:emu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EMQU_1045
Exosome [BR:emu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EMQU_1045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAO06602
UniProt: V5XNA9
Position
1089832..1091031
Genome map
AA seq 399 aa AA seqDB search
MKEVVIIDAARTPIGKYRGSLSSYSAVELGTFITTEILERTGINKEAINQVIFGNVLQAG
NGQNVARQIAINSGIPVSVPAMTINEVCGSGMKSVILARQQIQLGEADLIIAGGVESMTR
APMIQVSDPENEKIEEISSMVNDGLTDAFSNTHMGLTAENVAKQFSVTRAEQDQYALASQ
LKAGQASESGVFKEEIIPISRNEEVFATDEAVRGNSTLEKLSTLRTVFAEDGTVTAGNAS
PLNDGGSVLILASKDYAIAHGLPYLATIKGISEVGIDPSIMGVAPIKAINTLMEKTELSL
DDIDLFEINEAFAASSIVVNRELNLPSEKVNIYGGAIALGHPIGASGARILTTLGYALRR
QHQRYGVASLCIGGGLGLAVLLEANLQETGDNKKKSFMN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaagtcgttattatagatgctgcacgaacaccgattggaaagtatcgtggtagc
ttaagcagttattctgctgttgagttgggaacattcattacaacagaaatccttgaacga
acagggataaacaaagaagcaatcaatcaagtcatttttggaaatgtgcttcaagcaggg
aatgggcaaaatgttgcacgacaaattgcgatcaatagcggaatccccgttagtgttccg
gcaatgacaatcaatgaagtttgtggatctgggatgaaatcagtgatccttgcgcgtcaa
caaatccaactaggcgaagcggacctgatcatagccggtggtgttgaaagcatgactaga
gcgccgatgatccaagtgagcgatccagaaaacgagaaaatcgaagaaatctcaagtatg
gtcaatgatggattaaccgatgcattttccaatactcatatgggactgacagcagaaaat
gtggcaaaacaattttctgtgacgagagcagagcaagatcaatatgcactggcttcacaa
ttaaaagcaggacaagccagcgagtcaggggtcttcaaggaagaaatcattccaatttcc
cgtaatgaagaagtatttgcaacagatgaagcagtgcgaggaaatagtacattagaaaaa
ttaagcaccttacggacggtttttgcggaggacggcacagttactgctggaaatgcttca
cctttgaacgatggtggctctgtactgatcttagcgtctaaagactatgcgattgctcat
ggcttaccgtatttagctacgatcaaaggaatctctgaagttgggatcgatcccagtatc
atgggggtagctccaatcaaagcaatcaataccttgatggagaaaacagagctttccttg
gacgacatcgatctatttgaaattaacgaagcgtttgctgcgtcatcgatcgttgtgaat
cgtgaattgaatctcccatcagagaaagtcaatatttatggtggtgcgattgcgttaggc
catccgattggtgctagtggcgctcgtatcttgactactttaggctatgcgttaagaagg
cagcaccaacgatacggagtagcttcattatgtattggtggcggtcttggattagctgtt
cttttggaagctaatttgcaagaaactggtgataacaaaaaaaaaagttttatgaactaa

DBGET integrated database retrieval system