KEGG   Enterococcus mundtii: EMQU_1096Help
Entry
EMQU_1096         CDS       T02931                                 

Gene name
thyA
Definition
(GenBank) thymidylate synthase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
emu  Enterococcus mundtii
Pathway
emu00670  One carbon pool by folate
emu00790  Folate biosynthesis
emu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:emu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EMQU_1096 (thyA)
   00670 One carbon pool by folate
    EMQU_1096 (thyA)
Enzymes [BR:emu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EMQU_1096 (thyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: BAO06653
UniProt: V5XNL0
Position
1150044..1150556
Genome map
AA seq 170 aa AA seqDB search
MFAAIWAQDENGLIGKEDRLPWHLPNDLKFFKQMTEANVLIMGRKTFMGMGGKPLPNRKT
IVLTRDREFTAEGVLVMHDVNEVLAYEKEVDEILFVAGGSAIYEEFLPYCTILYRTVIHH
SFEGDTYFPAVDWQAWSLINISPGEIDEKNSYAHQFETYKRKEEHTTEEI
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgttcgctgcaatctgggcacaagatgaaaatggcctgatcggaaaagaagatagactt
ccttggcatttgccgaatgatttgaaattttttaagcaaatgactgaagcgaatgtattg
atcatgggacgaaaaacatttatggggatgggcggtaagccactacctaatcgtaaaacg
attgttttgacaagagaccgtgagtttacagccgagggcgtactagtgatgcatgatgtc
aatgaagtattagcttatgaaaaagaagtagatgaaattttatttgttgctggagggtca
gcaatctatgaagaatttttaccttactgcacaattttgtatcgtacggtgatccatcac
tctttcgaaggagatacgtattttcctgctgtagactggcaagcatggtcattgatcaat
atcagtccgggagaaatagatgaaaaaaatagttatgcacatcagtttgagacgtataaa
cgtaaagaagaacacacaacagaagagatataa

DBGET integrated database retrieval system