KEGG   Enterococcus mundtii: EMQU_1144Help
Entry
EMQU_1144         CDS       T02931                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
emu  Enterococcus mundtii
Pathway
emu00220  Arginine biosynthesis
emu00250  Alanine, aspartate and glutamate metabolism
emu00290  Valine, leucine and isoleucine biosynthesis
emu01100  Metabolic pathways
emu01110  Biosynthesis of secondary metabolites
emu01130  Biosynthesis of antibiotics
emu01210  2-Oxocarboxylic acid metabolism
emu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:emu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EMQU_1144
   00290 Valine, leucine and isoleucine biosynthesis
    EMQU_1144
   00220 Arginine biosynthesis
    EMQU_1144
Enzymes [BR:emu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     EMQU_1144
    2.6.1.66  valine---pyruvate transaminase
     EMQU_1144
Amino acid related enzymes [BR:emu01007]
 Aminotransferase (transaminase)
  Class I
   EMQU_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAO06701
UniProt: V5XP82
Position
1199346..1200563
Genome map
AA seq 405 aa AA seqDB search
MREFEKSNKLEGVSYDVRGPVLEEAERMQEEGISILKLNTGNPAPFGFEAPNEVIRDLIM
NARDSEGYSDSKGIFSARKAIEQYCQLKKFPNVTINDIYTGNGVSELITMCMQGLLDNGD
EVLVPMPDYPLWTASVSLAGGKPVHYVCDEQAEWYPDIEDIKSKVTSRTKAIVIINPNNP
TGALYPKELLEEIVKIAREHQLIIYSDEIYDRLVMDGLEHIPIATLAPDLFVVTLNGLSK
SHRVAGFRVGWMVLSGDKSNVKGYIEGLNMLSSMRLCSNVLSQQIIQTALGGYQSVDELL
LPGGRIYEQREYIYNAINDIPGLSAVKPKAAFYIFPKIDTKRFNITNDEQFVLDFLHEHK
ILLVHGGGFNWPDPDHFRIVYLPKLDDLKVTAKKMREFLTTYRQR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatttgaaaaatccaacaaattagaaggcgtaagttacgatgtccgcggaccg
gttcttgaagaagcagaacgaatgcaagaagagggcatcagtatattaaaattgaatacg
ggaaatccagcaccatttggatttgaggcaccaaatgaagtgatccgtgatttgatcatg
aatgccagagattcagaaggctattcggattcaaaagggattttttctgcacgaaaagcg
attgaacagtattgtcaattgaaaaaatttccaaatgtgacgatcaatgatatctatact
ggtaatggggtcagtgagctgatcacgatgtgtatgcaagggctgttggacaatggcgat
gaagtattagtgccaatgccggattatcctttatggacagcttctgtttctttggctgga
ggaaaaccagttcattatgtatgcgatgaacaagccgaatggtatccagatattgaggat
atcaaatctaaagttaccagccggacaaaggcaatcgtgatcatcaatcctaataatcca
acaggagctttatatccgaaagaattattagaagaaatcgtgaaaatcgcacgagaacat
caattgatcatttattcagacgaaatctatgatcgtttagtgatggatggcttagagcat
atcccgattgcgactttagcacctgatctattcgttgtcacattgaatggcctatctaaa
tcacatcgtgtggcgggattccgtgtcggctggatggtgttgagtggtgacaaatcaaat
gtaaaaggctatatcgaagggttgaatatgctttcctctatgcgtctttgttcaaatgtt
ctgtcacaacaaatcatccaaactgccctagggggctaccaaagtgtggatgaattgcta
ttgccaggtggacggatctacgaacaaagagaatacatttataatgcaatcaatgatatc
cctggattatcagcggttaagccgaaagcagctttttatatctttccaaaaatcgatacg
aaacgcttcaatattaccaatgatgagcagttcgtattagattttctgcacgagcataag
attttacttgttcacggaggcggttttaactggcctgatccagaccacttcagaatcgtt
tacttaccaaaattagacgatctaaaagtaacggcgaaaaaaatgcgtgaattcctgaca
acctaccgacaaagatag

DBGET integrated database retrieval system