KEGG   Escherichia coli NA114 (UPEC): ECNA114_0043Help
Entry
ECNA114_0043      CDS       T01998                                 

Gene name
surA
Definition
(GenBank) Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase)
  KO
K03771  peptidyl-prolyl cis-trans isomerase SurA [EC:5.2.1.8]
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ena03110]
    ECNA114_0043 (surA)
Enzymes [BR:ena01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     ECNA114_0043 (surA)
Chaperones and folding catalysts [BR:ena03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    ECNA114_0043 (surA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rotamase Rotamase_3 SurA_N Rotamase_2 SurA_N_3 SurA_N_2 Trigger_C DUF503
Motif
Other DBs
NCBI-ProteinID: AEG34865
Structure
PDB: 

Position
complement(43238..44524)
Genome map
AA seq 428 aa AA seqDB search
MKNWKTLLLGIAMIANTSFAAPQVVDKVAAVVNNGVVLESDVDGLMQSVKLNAAQARQQL
PDDATLRHQIMERLIMDQIILQMGQKMGVKISDEQLDQAIANIAKQNNMTLDQMRSRLAY
DGLNYNTYRNQIRKEMIISEVRNNEVRRRITILPQEVESLAQQVGNQNDASTELNLSHIL
IPLPENPTSDQVNEAESQARAIVDQARNGADFGKLAIAHSADQQALNGGQMGWGRIQELP
GIFAQALSTAKKGDIVGPIRSGVGFHILKVNDLRGESKNISVTEVHARHILLKPSPIMTD
EQARVKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLGWATPDIFDPAFRDALTRL
NKGQMSAPVHSSFGWHLIELLDTRNVDKTDAAQKDRAYRMLMNRKFSEEAASWMQEQRAS
AYVKILSN
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactggaaaacgctgcttctcggtatcgccatgatcgcgaataccagtttcgct
gccccccaggtagtcgataaagtcgcagccgtcgtcaataacggcgtcgtgctggaaagc
gacgttgatggattaatgcagtcggtaaaactgaacgctgctcaggcaaggcaacaactt
cctgatgacgcgacgctgcgccaccaaatcatggaacgtttgatcatggatcaaattatc
ctgcagatggggcagaaaatgggagtgaaaatctccgatgagcagctggatcaggcgatt
gctaacatcgcgaaacagaacaacatgacgctggatcagatgcgcagccgtctggcttac
gatggtctgaactacaacacctatcgtaaccagatccgcaaagagatgattatctctgaa
gtgcgtaacaacgaggtgcgtcgtcgcatcaccatcctgccgcaggaagtcgaatccctg
gcgcagcaagtgggtaaccaaaacgacgccagcactgagctgaacctgagccacatcctg
atcccgctgccggaaaacccgacctctgatcaggtgaacgaagcggaaagccaggcgcgc
gcgattgtcgatcaggcgcgtaacggcgctgatttcggtaagctggcgattgctcattct
gccgaccagcaggcgctgaacggcggccagatgggctggggccgtattcaggagttgccg
gggatcttcgcccaggcattaagcaccgcgaagaaaggcgacattgttggcccgattcgt
tccggcgttggcttccatattctgaaagttaacgacctgcgcggcgaaagcaaaaatatc
tcggtgaccgaagttcatgctcgccatattctgctgaaaccgtcgccgatcatgactgac
gaacaggcccgcgtgaaactggaacagattgctgccgatatcaagagtggtaaaacgact
tttgctgccgcagcgaaagagttctctcaggatccaggctctgctaaccagggcggtgat
ctcggctgggctacaccagatattttcgatccggccttccgtgacgccctgacccgcctg
aacaaaggtcaaatgagtgcaccggttcactcttcattcggctggcatttaatcgaactg
ctggatacccgtaatgtcgataaaaccgacgcggcacagaaagatcgtgcataccgcatg
ctgatgaaccgtaagttctcggaagaagcagcaagctggatgcaggaacaacgtgccagc
gcctacgttaaaatcctgagcaactaa

DBGET integrated database retrieval system