KEGG   Escherichia coli NA114 (UPEC): ECNA114_0658Help
Entry
ECNA114_0658      CDS       T01998                                 

Gene name
sdhD
Definition
(GenBank) Succinate dehydrogenase
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00020  Citrate cycle (TCA cycle)
ena00190  Oxidative phosphorylation
ena00650  Butanoate metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01130  Biosynthesis of antibiotics
ena01200  Carbon metabolism
Module
ena_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ena_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ena_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECNA114_0658 (sdhD)
   00650 Butanoate metabolism
    ECNA114_0658 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECNA114_0658 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AEG35480
Structure
PDB: 

Position
715691..716038
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgt
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggattggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggccttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system