KEGG   Escherichia coli NA114 (UPEC): ECNA114_0838
Entry
ECNA114_0838      CDS       T01998                                 

Gene name
trxB
Definition
(GenBank) Thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_0838 (trxB)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     ECNA114_0838 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 GIDA FAD_oxidored K_oxygenase NAD_binding_8 NAD_binding_7 FMO-like Thi4 Trp_halogenase
Other DBs
NCBI-ProteinID: AEG35660
Structure
PDB: 
1TRB 1TDE 1TDF 1CL0 1F6M

Position
complement(898977..899942)
AA seq 321 aa
MGTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDL
TGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLTGDSGEYTCDALIIATGASARYL
GLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDG
FRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNTDNIESLDVAGL
FVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSA
GTGCMAALDAERYLDGLADAK
NT seq 966 nt   +upstreamnt  +downstreamnt
atgggcacgaccaaacacagtaaactgcttatcctgggttcaggcccggcgggatacacc
gctgctgtctacgcggcgcgcgccaacctgcaacctgtgctgattaccggcatggaaaaa
ggcggccaactgaccaccaccacggaagtggaaaactggcctggcgatccaaacgatctg
accggtccgttattaatggagcgcatgcacgaacatgccaccaaatttgaaactgaaatc
atctttgatcacatcaacaaagttgatttgcagaatcgtccgttccgtctgactggcgat
agcggcgaatacacttgcgacgcgctgattattgccaccggagcttctgcacgctatctc
ggcctgccctctgaagaagcctttaaaggccgtggagtttctgcttgtgcaacctgcgac
ggtttcttctatcgcaaccagaaagttgcggtcatcggcggcggcaataccgcggttgaa
gaggcgctgtatctgtctaacatcgcttcggaagttcatctgattcaccgccgtgatggt
ttccgtgcggaaaaaatcctcattaagcgtctgatggataaagtggagaacggcaacatt
attctgcacaccaaccgtacgctggaagaagtgaccggcgatcagatgggcgtcactggc
gttcgtctgcgcgatacgcaaaacaccgataatatcgagtcactcgacgttgccggtctg
tttgttgctatcggtcacagcccgaatactgccattttcgaagggcagctggaactggaa
aacggctacatcaaagtacagtcgggtattcatggtaatgccacccagaccagcatccct
ggcgtctttgccgcaggcgacgtgatggatcacatttatcgccaggccattacatctgct
ggtacaggctgcatggcagctcttgatgcggaacgctacctcgacggtttagctgacgca
aaataa

DBGET integrated database retrieval system