KEGG   Escherichia coli NA114 (UPEC): ECNA114_0886Help
Entry
ECNA114_0886      CDS       T01998                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00340  Histidine metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01230  Biosynthesis of amino acids
Module
ena_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    ECNA114_0886 (hisD)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     ECNA114_0886 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh FdhE
Motif
Other DBs
NCBI-ProteinID: AEG35709
Structure
PDB: 

Position
complement(943091..944395)
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAKFDK
TTVTALKVSADEIAAASERLSDELKQAMAVAVKNIETFHTAQKLPPVDVETQPGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCGVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAETARQ
ALSASRLIVTNDLAQCVEISNQYGPEHLIIQTRNARDLVDSITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAERLTAHK
NAVTLRVNVLKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcaccgttaacgatattctc
gataacgtgaaaacgcgtggcgatgaggccctgcgtgaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtgtctgctgatgagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagaatattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagccaggcgtgcgttgccagcaggtc
acgcgcccggtggcttcagtgggtttgtatattcctggcggctccgccccgctcttctca
acggtattaatgctggcgactccggcgcgtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgagatcctttatgcggcgcaactgtgcggtgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcaaaacgccag
gtaagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgcaacgccggatttcgtggcttctgatttgctctcccaggct
gaacacggcccggactcacaggtgattttactgacacctgatgctgatatggcgcgtcgc
gttgccgaggccgtcgaacgccagttggcagaattgccgagagctgaaaccgcccgtcag
gcactgagcgccagccgcctgatcgtaaccaacgatttagcgcagtgcgtagagatctcc
aatcagtacggtccggagcacctgatcattcagacccgcaacgcccgcgatctcgtcgat
agcattaccagcgccggttcggtatttctcggtgactggtcaccggaatcggcaggtgat
tacgcctccggcaccaaccacgtgctgccgacttacggttacaccgccacctgttccagc
ctcgggctggcagatttccagaaacgcatgaccgtacaggaactgtcgaaagaaggtttc
tccgcgctggcttcgaccattgaaacactggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgtccttaaggagcaagcatga

DBGET integrated database retrieval system