KEGG   Escherichia coli NA114 (UPEC): ECNA114_1433Help
Entry
ECNA114_1433      CDS       T01998                                 

Gene name
ppiB
Definition
(GenBank) Peptidyl-prolyl cis-trans isomerase
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ena03110]
    ECNA114_1433 (ppiB)
Enzymes [BR:ena01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     ECNA114_1433 (ppiB)
Chaperones and folding catalysts [BR:ena03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    ECNA114_1433 (ppiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-ProteinID: AEG36258
Structure
PDB: 

Position
complement(1439299..1439793)
Genome map
AA seq 164 aa AA seqDB search
MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVINGFMIQGGGFEPGMK
QKATKDPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLNFSGESLQGWGY
CVFAEVVEGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTVSE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggttactttccacaccaatcacggcgatattgtcatcaaaacttttgacgataaagca
cctgaaacagttaaaaacttcctggactactgccgcgaaggtttttacaacaacaccatt
ttccaccgtgttatcaacggctttatgattcagggcggcggttttgaaccgggcatgaaa
caaaaagccaccaaagacccgatcaaaaacgaagcgaacaacggtctgaaaaatacccgt
ggtacgctggcaatggcccgtactcaggcaccgcactctgcaactgcccagttcttcatc
aacgtggttgataacgacttcctgaacttctctggcgaaagcctgcaaggttggggctac
tgcgtatttgctgaagtggttgaaggcatggacgtggtagacaaaatcaaaggtgtggca
accggtcgtagcggtatgcaccaggacgtgccaaaagaagacgttatcattgaaagcgtg
accgttagcgagtaa

DBGET integrated database retrieval system