KEGG   Escherichia coli NA114 (UPEC): ECNA114_1632
Entry
ECNA114_1632      CDS       T01998                                 

Gene name
ynfE
Definition
(GenBank) Putative dimethyl sulfoxide reductase chain A
  KO
K07309  Tat-targeted selenate reductase subunit YnfE [EC:1.97.1.9]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_1632 (ynfE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_1632 (ynfE)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.97  Other oxidoreductases
   1.97.1  Sole sub-subclass for oxidoreductases that do not belong in the other subclasses
    1.97.1.9  selenate reductase
     ECNA114_1632 (ynfE)
Transporters [BR:ena02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   ECNA114_1632 (ynfE)
SSDB
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4 EcoRI_methylase
Other DBs
NCBI-ProteinID: AEG36457
Position
1639970..1642396
AA seq 808 aa
MSKNEQMVGISRRTLVKSTAIGSLALAAGGFSLPFTLRSAAAAVQQASEKVVWGACSVNC
GSRCALRLHVKDNEVTWVETDNTGSDKYGNHQVRACLRGRSIRRRINHPDRLNYPMKRVG
KRGEGKFERISWDEALDTIASSLKKTVEQYGNEAVYIQYSSGIVGGNMTRSSPSASAVKR
LMNCYGGSLNQYGSYSTAQISCAMPYTYGSNDGNSTTDIENSKLVVMFGNNPAETRMSGG
GITYLLEKAREKSNAKMIVIDPRYTDTAAGREDEWLPIRPGTDAALVAGIAWVLINENLV
DQPFLDKYCVGYDEKTLPADAPKNGHYKAYILGEGDDKTAKTPQWASQITGIPVDRIIKL
AREIGTAKPAYICQGWGPQRQANGELTARAIAMLPILTGNVGISGGNSGARESTYTITIE
RLPVLDNPVKTSISCFSWTDAIDHGPQMTAIRDGVRGKDKLDVPIKFIWNYAGNTLVNQH
SDINKTHEILQDESKCEMIVVIENFMTSSAKYADILLPDLMTVEQEDIIPNDYAGNMGYL
IFLQPVTSEKFERKPIYWILSEVAKRLGPDVYQKFTEGRTQEQWLQHLYAKMLAKDPALP
SYDELKKMGIYKRKDPNGHFVAYKAFRDDPEANPLKTPSGKIEIYSSKLAEIARTWELEK
DEVISPLPVYASTFEGWDSPERSTFPLQLFGFHYKSRTHSTYGNIDVLKAACRQEVWINP
IDAQKRGIANGDMVRVFNHRGEVRLPAKVTPRILPGVSAMGQGAWHEANMSGDKIDHGGC
VNTLTTLRPSPLAKGNPQHTNLVEIEKI
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgtccaaaaatgaacaaatggtgggcatcagccgcagaacactcgttaaatctactgcg
ataggttctctggcgctggctgcaggcggtttttctttgccgtttaccctgcgcagtgca
gcagcagcggtacaacaggccagcgaaaaagtggtctggggtgcctgttccgtcaactgt
ggtagccgctgtgcacttcgtctgcatgttaaagataatgaagtgacctgggtggaaact
gacaacaccggcagcgacaagtatggcaaccatcaggtacgcgcctgtttgcgcggtcgc
tccatccgtcggcgtattaatcatcccgatcgcctgaattacccaatgaaacgcgtgggc
aaacgcggcgaaggcaaattcgaacggattagctgggatgaagccctggatactatcgcc
agtagcctgaaaaaaaccgtcgaacaatatggcaatgaggctgtatatattcagtactct
tcggggattgttggcggcaatatgacccgctcttctccatcagcctcggcggtcaaacgc
ctgatgaactgctacggcggttcactaaaccagtatggctcctacagcactgcgcaaatt
tcctgtgccatgccctacacctacggcagtaatgatggcaacagcaccacggatattgaa
aacagcaagctggtcgtgatgtttggtaacaacccggctgaaacccgcatgagcggcggt
ggcatcacttatcttcttgaaaaagcgcgcgagaaatcgaacgcaaaaatgattgttatc
gatccgcgatataccgatacggctgctggtcgtgaagatgaatggcttcctattcgcccg
ggcaccgatgccgcgctggttgcgggtattgcctgggtattgattaacgaaaatctcgtt
gatcaaccttttctcgataaatactgcgtcggctatgacgaaaaaaccttacccgcagat
gcacccaaaaatggtcactataaagcctatattcttggtgaaggtgatgataaaacagcg
aaaacgccgcagtgggcttcgcaaattacaggtatcccggtagaccgtatcatcaaactg
gcgcgtgaaattggcacagcaaaacccgcttatatctgccagggctgggggccgcaacgg
caggcaaacggcgagctgacggcacgcgctattgctatgttgcctattttgacgggcaat
gtcggcatcagcggcggaaatagtggtgcgcgtgaatcgacctacaccattaccatcgaa
cgcctgccggtgctggataatccggtcaaaacgtcaatctcctgcttcagttggacagat
gctatcgatcatggcccgcaaatgacggcaatccgcgacggcgtccggggcaaagataaa
ctagatgtgcccattaagttcatctggaactacgcgggaaataccctggttaatcagcat
tctgacatcaacaaaacgcatgaaattctgcaggacgaatcgaaatgcgaaatgattgtg
gtcatcgaaaactttatgacctcatcggcaaaatatgccgacattctgctgccagaccta
atgaccgttgagcaggaagatattattcctaacgactacgccggtaacatgggatatctc
attttcctccagcctgtcaccagcgaaaaattcgaacgcaaaccaatttactggatcctg
agtgaagtcgcgaaacgtcttggacctgacgtctatcaaaagttcactgaaggtcgcacg
caagaacaatggttacaacatctgtacgccaaaatgcttgccaaagatccggcgttaccg
tcttacgacgaattaaaaaaaatgggtatctataagcgtaaagatcccaatggtcatttt
gtcgcctacaaagcatttcgtgacgaccccgaggcaaatccacttaaaacgccttccggt
aagattgaaatttattccagcaagctggcggaaattgcccgtacctgggaactggaaaaa
gatgaagtgataagcccactgccggtttatgcctcaacctttgaagggtgggactcccct
gaacgtagtaccttcccactgcaactgtttggtttccattacaaatcccgtacgcactcg
acctacggcaacattgatgtcctgaaggcagcctgccgtcaggaagtgtggatcaaccct
atagatgcacagaaacgtgggattgccaacggcgatatggtgcgggtgtttaaccatcgt
ggcgaagttcggctaccagccaaagtgacaccacgcattctccctggagttagtgctatg
ggccagggagcctggcacgaggccaatatgtctggcgataaaatcgaccacggcggctgt
gtgaatacgctaaccactctgcgcccttcaccactggcgaagggaaacccgcagcacact
aatctggtcgagatcgaaaaaatataa

DBGET integrated database retrieval system