KEGG   Escherichia coli NA114 (UPEC): ECNA114_1669
Entry
ECNA114_1669      CDS       T01998                                 

Definition
(GenBank) Cystathionine beta-lyase
  KO
K14155  cysteine-S-conjugate beta-lyase [EC:4.4.1.13]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00270  Cysteine and methionine metabolism
ena00450  Selenocompound metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01230  Biosynthesis of amino acids
Module
ena_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECNA114_1669
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_1669
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ena01007]
    ECNA114_1669
Enzymes [BR:ena01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.13  cysteine-S-conjugate beta-lyase
     ECNA114_1669
Amino acid related enzymes [BR:ena01007]
 Aminotransferase (transaminase)
  Class II
   ECNA114_1669
SSDB
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Other DBs
NCBI-ProteinID: AEG36497
Structure
PDB: 
1D2F

Position
1681781..1682953
AA seq 390 aa
MFDFSKVVDRHGTWCTQWDYVADRFGTADLLPFTISDMDFATAPCIIEALNQRLIHGVFG
YSRWKNDEFLAAIAHWFSTQHYTAIDPQSVVYGPSVIYMVSELIRQWSETGEGVVIHTPA
YDAFYKAIEGNQRTVMPVALEKQADGWFCDMGKLEAVLAKPECKIMLLCSPQNPTGKVWT
CDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIPWSNVARGDWALLTSGSKSFNIPAL
TGAYGIIENSSSRDAYLSALKGRDGLSSPSVLALTAHIAAYQQGAPWLDALRVYLKDNLT
YIADKMNAAFPELNWQIPQSTYLAWLDLRPLNIDDNALQKALIEQEKIAIMPGYTYGEEG
RGFVRLNAGCPRSKLEKGVAGLINAIRAVG
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgttcgatttttcaaaggtcgtggatcgtcatggcacatggtgtacgcagtgggattat
gtcgctgaccgtttcggcactgctgacctgttaccgttcacgatttcagacatggatttt
gccactgccccctgcattatcgaggcgctgaatcagcgcctgatacacggcgtgtttggc
tacagccgctggaaaaacgatgagtttctcgcggctattgcccactggttttccacccag
cattacaccgccatcgatcctcagtcggtggtgtatggcccttctgttatctatatggtt
tcagaactgattcgtcagtggtctgaaacaggtgaaggcgtggtgatccacacacccgcc
tatgacgcattttacaaggccattgaaggtaaccagcgcacagtaatgcccgttgcttta
gagaagcaggctgacggctggttttgcgatatgggcaagctggaagccgtgctggcgaaa
ccagaatgtaaaattatgctcctgtgtagcccacagaatcctaccgggaaagtgtggacg
tgcgatgagctggagatcatggctgacctgtgcgagcgtcatggtgtgcgggttatttcc
gatgaaatccatatggatatggtttggggcgagcagccgcatattccctggagtaatgtg
gcgcgcggagactgggcgttgctaacgtcgggatcaaaaagtttcaatattcccgccctg
accggtgcttacgggattatagaaaatagcagtagccgcgatgcctatttatcggcactg
aaaggacgtgatgggctttcttccccttcggtactggcgttaactgctcatatcgccgcc
tatcagcaaggcgcgccatggctggatgccttacgcgtctatctgaaagataacctgacg
tatatcgcagataaaatgaacgctgcgtttcctgaactcaactggcagatcccgcaatcc
acttatctggcctggcttgatctacgtccgttgaatattgacgacaacgcgttgcaaaaa
gcgcttatcgagcaagaaaagatcgcgatcatgccgggatatacctacggtgaagaaggt
cgtggttttgtccgactcaatgccggctgcccacgttcgaaactggaaaaaggtgtggct
ggattaattaacgccatccgcgctgttggttaa

DBGET integrated database retrieval system