KEGG   Escherichia coli NA114 (UPEC): ECNA114_1727
Entry
ECNA114_1727      CDS       T01998                                 

Definition
(GenBank) Bifunctional cysteine desulfurase/selenocysteine lyase
  KO
K11717  cysteine desulfurase / selenocysteine lyase [EC:2.8.1.7 4.4.1.16]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00450  Selenocompound metabolism
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_1727
Enzymes [BR:ena01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     ECNA114_1727
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.16  selenocysteine lyase
     ECNA114_1727
SSDB
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1
Other DBs
NCBI-ProteinID: AEG36555
Structure
PDB: 

Position
complement(1735511..1736731)
AA seq 406 aa
MTFSVDKVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAEFYRHGYAAVHRGIHT
LSAQATEKMENVRKRASLFINARSAEELVFVRGTTEGINLVANSWGNSNVRAGDNIIISQ
MEHHANIVPWQMLCARVGAELRVIPLNPDGTLQLETLPTLFDEKTRLLAITHVSNVLGTE
NPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQALDCDFYVFSGHKLYGPTGIGVLYVKE
ALLQEMPPWEGGGSMIAAVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLN
NIAEYEQNLMHYALAQLESVPDLTLYGPQNRLGVIAFNLGKHHAYDVGSFLDNYGIAVRT
GHHCAMPLMAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRIHRLLG
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgactttttccgtcgacaaagtgcgggccgactttccggtgctttctcgtgaggtaaac
ggtttgccgctggcttatctcgacagtgccgccagtgcgcagaaaccaagccaggtgatt
gacgccgaggctgagttttatcgtcacggctacgcggcggtgcatcgcggtattcatacc
ttaagcgcccaggcgaccgagaaaatggagaacgtgcgcaagcgggcatcgctgtttatt
aatgcccgttcggcggaagagctggtgttcgtccgcggcacgacggaagggatcaatctg
gtcgccaatagctggggcaacagcaatgtgcgagcgggcgataacatcatcatcagtcag
atggagcaccacgctaacattgtcccctggcagatgctttgcgcacgcgttggcgcagag
ctgcgtgtgatcccgctcaaccccgacggtactctgcaactggagacgctgcctacgctg
tttgatgagaaaactcgcctgctggcaattactcatgtctccaacgtgcttgggacagaa
aatccgctggcggagatgatcacacttgcgcatcaacatggcgcaaaagtgctggtggat
ggcgctcaggcggtgatgcatcatccggtggatgttcaggcgctggattgcgatttctac
gtgttttccgggcataaactgtatggtcccaccggcattggcgtgctgtatgtcaaagaa
gccttgttgcaggagatgccgccgtgggaagggggcggttctatgattgccgccgttagc
ctgagtgaaggcactacctggaccaaagcgccgtggcggtttgaagccggtacgcccaat
accggaggtattattggccttggcgcggcgctggagtatgtttcggcgctggggcttaat
aacatagccgagtatgaacagaatctgatgcactacgcgctagcacagctggaatctgta
ccggatctcactctctatggcccacagaacaggcttggcgttattgcttttaatctcggt
aaacaccacgcctatgatgttggcagttttctcgataattacggcattgctgtgcgtacc
ggacatcactgcgctatgccattaatggcctattacaacgtccccgcgatgtgtcgggcg
tcgctggcaatgtacaacacccatgaagaagtggatcgtctggtaactggattgcaacgt
attcatcgtctactggggtaa

DBGET integrated database retrieval system