KEGG   Escherichia coli NA114 (UPEC): ECNA114_1809
Entry
ECNA114_1809      CDS       T01998                                 

Gene name
selD
Definition
(GenBank) Selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00450  Selenocompound metabolism
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_1809 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ena03016]
    ECNA114_1809 (selD)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     ECNA114_1809 (selD)
Transfer RNA biogenesis [BR:ena03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    ECNA114_1809 (selD)
 Prokaryotic type
    ECNA114_1809 (selD)
SSDB
Motif
Pfam: AIRS_C AIRS
Other DBs
NCBI-ProteinID: AEG36637
Structure
PDB: 
3U0O

Position
complement(1819661..1820704)
AA seq 347 aa
MSENSIRLTQYSHGAGCGCKISPKVLETILHSEQAKFVDPNLLVGNETRDDAAVYDLGNG
TSVISTTDFFMPIVDNPFDFGRIAATNAISDIFAMGGKPIMAIAILGWPINKLSPEIARE
VTEGGRYACRQAGIALAGGHSIDAPEPIFGLAVTGIVPTERVKKNSTAQAGCKLFLTKPL
GIGVLTTAEKKSLLKPEHQGLATEVMCRMNIAGVSFANIEGVKAMTDVTGFGLLGHLSEM
CQGAGVQARVDYDAIPKLPGVEEYIKLGAVPGGTERNFASYGHLMGEMPREVRDLLCDPQ
TSGGLLLAVMPEAENEVKATAAEFGIELTAIGELVPARGGRAMVEIR
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgagcgagaactcgattcgtttgacccaatacagccacggcgctggttgcggctgtaaa
atttccccaaaagtgttggaaaccatcctgcacagtgagcaggcgaagtttgttgatccg
aatttgcttgtgggtaatgaaacccgcgacgatgcggcggtgtacgatctgggcaatggc
accagcgttatcagtaccaccgacttctttatgccgatcgttgataatcctttcgatttt
ggccgcattgcggcgactaacgccatcagcgatatctttgctatgggcggcaaaccgatt
atggcgattgcgatcctcggctggccgattaacaaactttccccggaaattgcccgcgaa
gtgaccgaaggtggacgctatgcatgccgtcaggcgggtattgcgctggctggcggtcac
tccatcgatgcgccggagccgatttttggtctggcggtaacggggatcgtaccgaccgag
cgggtgaagaaaaacagtaccgcacaagccggatgcaaactgttcctgacgaaaccgctg
gggattggcgttcttaccacggctgagaaaaaatcactgctgaaaccagaacatcaggga
ctggcgacggaagtgatgtgccggatgaacatcgcaggcgtgtcctttgccaacatcgaa
ggcgtaaaagcgatgaccgacgttacgggttttggtttactggggcatttaagcgaaatg
tgtcagggcgcaggtgtgcaggcgcgcgtcgactatgacgcgatcccgaaattgccgggg
gttgaagagtacattaagttgggcgcagtgcctggcggcaccgaacgtaactttgccagc
tacggtcatctgatgggtgaaatgccgcgtgaagtgcgcgatctgctgtgcgatccgcaa
acttctggcggtttgctgctggcggtcatgccggaagcagaaaatgaggtcaaagctaca
gccgccgagtttggcattgaactgacggcgattggcgaactggtgccagcgcgcggcggt
cgtgccatggttgagatccgttaa

DBGET integrated database retrieval system