KEGG   Escherichia coli NA114 (UPEC): ECNA114_2147Help
Entry
ECNA114_2147      CDS       T01998                                 

Gene name
cpsB
Definition
(GenBank) Mannose-1-phosphate guanylyltransferase-GDP
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00051  Fructose and mannose metabolism
ena00520  Amino sugar and nucleotide sugar metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECNA114_2147 (cpsB)
   00520 Amino sugar and nucleotide sugar metabolism
    ECNA114_2147 (cpsB)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     ECNA114_2147 (cpsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase MannoseP_isomer Cupin_2 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEG36978
Position
complement(2145869..2147305)
Genome map
AA seq 478 aa AA seqDB search
MAQSKLYPVVMAGGSGSRLWPLSRVLYPKQFLCLKGDLTMLQTTICRLNGVECESPVVIC
NEQHRFIVAEQLRQLNKLTENIILEPAGRNTAPAIALAALAAKRHSPENDPLMLVLAADH
VIADEDAFRAAVRNAMPYAEAGKLVTFGIVPDLPETGYGYIRRGEVSAGEQDTVAFEVAQ
FVEKPNLETAQAYVASGEYYWNSGMFLFRAGRYLEELKKYRPDILDACEKAMSAVDPDLD
FIRVDEEAFLACPEESVDYAVMERTADAVVVPMDAGWSDVGSWSSLWEISAHTAEGNVCH
GDVINHKTENSYVYAESGLVTTVGVKDLVVVQTKDAVLIADRNAVQDVKKVVEQIKADGR
HEHRVHREVYRPWGKYDSIDAGDRYQVKRITVKPGEGLSVQMHHHRAEHWVVVAGTAKVT
IDGDIKLLGENESIYIPLGATHCLENPGKIPLDLIEVRSGSYLEEDDVVRFADRYGRV
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtcgaaactctatccagttgtgatggcaggtggctccggtagccgcttatgg
ccgctttcccgcgtactttaccccaagcagtttttatgcctgaaaggcgatctcaccatg
ctgcaaaccaccatctgccgcctgaacggcgtggagtgcgaaagcccggtggtgatttgc
aatgagcagcaccgctttattgtcgcggaacagctgcgtcaactaaataaactcaccgag
aacattattctcgaaccggcggggcgtaacaccgcacctgccattgcgctggcggcgctg
gcggcaaaacgtcatagcccggagaacgacccattaatgctggtgctggcggcggatcat
gtgattgccgatgaagacgcgttccgtgccgccgtgcgtaatgccatgccgtatgccgaa
gcgggcaagctggtgaccttcggcattgtgccggatctacctgaaaccggatatggctat
attcgtcgcggtgaagtgtcggcgggtgagcaggatacggtggcctttgaagtggcgcag
tttgtcgaaaaaccgaatctggaaaccgcgcaggcctatgtggcaagtggcgaatattac
tggaacagcggtatgttcctgttccgtgccggacgttatctcgaagaactgaaaaagtat
cgtccggatattctcgatgcctgtgaaaaagcgatgagcgccgtcgatccggatctcgat
tttattcgtgtggatgaagaggcgtttctcgcctgtccggaagagtcggtagattacgcg
gtcatggaacgcacggcagatgccgttgtggtgccgatggatgcgggctggagtgatgtc
ggttcctggtcctctttatgggagatcagtgcccacaccgccgagggcaacgtttgccat
ggcgatgtgattaatcacaaaactgaaaacagctatgtgtatgccgaatctggcctggtc
accaccgtcggggtgaaagatttggtggtagtgcagaccaaagatgcagtgctgattgct
gaccgtaacgcggtgcaggatgtgaaaaaagtggtcgagcagatcaaagctgatggtcgc
catgagcatcgggtgcatcgcgaagtgtatcgtccgtggggcaaatatgactctatcgac
gcgggcgaccgctaccaggtgaaacgcatcaccgtgaaaccgggcgaagggttgtcggta
cagatgcatcatcaccgcgcggaacactgggtggttgtcgcgggaacggcaaaagtcact
atcgacggtgatatcaaactgcttggtgaaaacgagtccatttatattccgctgggggcg
acgcattgcctggaaaacccggggaaaattccgctcgatttaattgaagtgcgctccggc
tcttatctcgaagaggatgatgtggtgcgcttcgcggatcgctacggacgggtgtaa

DBGET integrated database retrieval system