KEGG   Escherichia coli NA114 (UPEC): ECNA114_2470Help
Entry
ECNA114_2470      CDS       T01998                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00010  Glycolysis / Gluconeogenesis
ena00052  Galactose metabolism
ena00500  Starch and sucrose metabolism
ena00520  Amino sugar and nucleotide sugar metabolism
ena00521  Streptomycin biosynthesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01130  Biosynthesis of antibiotics
ena01200  Carbon metabolism
Module
ena_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ena_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ena00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNA114_2470 (glk)
   00052 Galactose metabolism
    ECNA114_2470 (glk)
   00500 Starch and sucrose metabolism
    ECNA114_2470 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    ECNA114_2470 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECNA114_2470 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ECNA114_2470 (glk)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     ECNA114_2470 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AEG37305
Structure
PDB: 

Position
complement(2515341..2516306)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttactgctgtgtcgatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtagaaggtaagcctattgcggtttacggtgccggaacagggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccaggagaaggcggtcac
gttgattttgcgccgaatagtgaagaagagggcattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggaacgcgtgctttctggccctgggctggtgaatttgtatcgc
gcaattgttaaagccgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgcgcgttgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggtggtatcgtgccgcgctttcttgagttcttcaaagcctctggtttccgcgccgca
tttgaagataaagggcgctttaaggaatatgtccatgatattccggtatatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctctaa

DBGET integrated database retrieval system