KEGG   Escherichia coli NA114 (UPEC): ECNA114_2790
Entry
ECNA114_2790      CDS       T01998                                 

Gene name
cysN
Definition
(GenBank) Subunit 1 of sulfate adenylyltransferase
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00230  Purine metabolism
ena00261  Monobactam biosynthesis
ena00450  Selenocompound metabolism
ena00920  Sulfur metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
Module
ena_M00176  Assimilatory sulfate reduction, sulfate => H2S
ena_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ECNA114_2790 (cysN)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECNA114_2790 (cysN)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_2790 (cysN)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ECNA114_2790 (cysN)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     ECNA114_2790 (cysN)
SSDB
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2 SRPRB
Other DBs
NCBI-ProteinID: AEG37625
Position
complement(2844278..2845705)
AA seq 475 aa
MNTALAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLS
SLHNDSKRHGTQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQY
TRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHLVVAINKMDLVDYSEETF
TRIREDYLTFAGQLPGNLDIRFVPLSALEGDNVASQSESMPWYSGPTLLEVLETVEIQRV
VDAQPMRFPVQYVNRPNLDFRGYAGTLASGRVEVGQRVKVLPSGVESNVARIVTFDGDRE
EAFAGEAITLVLTDEIDISRGDLLLAADEVLPAVQSASVDVVWMAEQPLSPGQSYDIKIA
GKKTRARVDGIRYQVDINNLTQREVENLPLNGIGLVDLTFDEPLVLDRYQQNPVTGGLIF
IDRLSNVTVGAGMVHEPVSQATAAPSEFSAFELELNALVRRHFPHWGARDLLGDK
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgaacaccgcacttgcacaacaaatcgccaatgaaggcggcgtcgaagcctggatgatt
gcgcaacaacataaaagcctgctgcgttttctgacctgtggtagcgtcgatgacggcaaa
agtaccctgattggtcgcctgctacacgatacccgccaaatctacgaagatcagctctca
tcgctgcataacgacagtaagcgtcacggcacccagggcgaaaagctggatctggcactg
ctggtggacggcctgcaagctgagcgcgaacagggcatcaccattgacgtggcttaccgc
tatttctctaccgagaagcgtaaatttattatcgccgacaccccagggcacgagcagtac
acccgcaatatggcgactggcgcatcgacatgtgaactggcgatcttactgatcgatgcc
cgtaaaggcgtgctcgatcaaacccgtcgtcacagttttatctccacactgttggggatc
aaacatctggtcgtggcgatcaacaaaatggatctggtggattacagtgaagagacgttc
acccgtattcgtgaagattatctgacctttgccgggcagctgccgggtaatctggatatc
cgctttgtgccgctctccgcactggaaggcgacaacgtggcttcgcaaagtgaaagtatg
ccgtggtacagcggtccgacactgctcgaagtgctggaaaccgtggagatccagcgagtg
gtggatgctcagccaatgcgcttcccggtgcagtacgttaaccgtccgaatctcgatttt
cgtggctacgccggaacgctggcatccggtcgtgtggaagtcgggcaacgtgtcaaagtg
ctgccctctggtgtggaatcaaacgtcgcgcggatcgtgacctttgatggcgatcgcgaa
gaagcctttgccggagaagcgatcaccctggtgctgacggatgagatcgacatcagccgt
ggcgatctgctgctggcggcagacgaagtgttaccggctgtgcagagcgcgtcggtggat
gtggtatggatggcggaacagccgctttccccgggccagagttacgacatcaaaattgcc
ggtaagaagacgcgtgctcgtgttgatggcattcgttatcaggttgatatcaataacctt
acccaacgcgaagttgaaaacctgccgctgaacggcatcggcctggtagatctcaccttt
gacgagccactggtgttagatcgttatcagcaaaacccggttaccggtgggctgattttt
atcgatcgcctgagtaatgtgaccgtaggtgccggtatggtgcacgaaccagttagccag
gcaactgctgcgccatctgaattcagtgcattcgaactggaattgaatgccctggttcgc
cgccatttcccgcattggggtgcgcgcgatttactgggagataaataa

DBGET integrated database retrieval system