KEGG   Escherichia coli NA114 (UPEC): ECNA114_2791
Entry
ECNA114_2791      CDS       T01998                                 

Gene name
cysD
Definition
(GenBank) Subunit 2 sulfate adenylyltransferase
  KO
K00957  sulfate adenylyltransferase subunit 2 [EC:2.7.7.4]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00230  Purine metabolism
ena00261  Monobactam biosynthesis
ena00450  Selenocompound metabolism
ena00920  Sulfur metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
Module
ena_M00176  Assimilatory sulfate reduction, sulfate => H2S
ena_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ECNA114_2791 (cysD)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECNA114_2791 (cysD)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ECNA114_2791 (cysD)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    ECNA114_2791 (cysD)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     ECNA114_2791 (cysD)
SSDB
Motif
Pfam: PAPS_reduct
Other DBs
NCBI-ProteinID: AEG37626
Position
complement(2845707..2846615)
AA seq 302 aa
MDQKRLTHLRQLEAESIHIIREVAAEFSNPVMLYSIGKDSSVMLHLARKAFYPGTLPFPL
LHVDTGWKFREMYEFRDRTAKAYGCELLVHKNPEGVAMGINPFVHGSAKHTDIMKTEGLK
QALNKYGFDAAFGGARRDEEKSRAKERIYSFRDRFHRWDPKNQRPELWHNYNGQINKGES
IRVFPLSNWTEQDIWQYIWLENIDIVPLYLAAERPVLERDGMLMMIDDNRIDLQPGEVIK
KRMVRFRTLGCWPLTGAVESNAQTLPEIIEEMLVSTTSERQGRVIDRDQAGSMELKKRQG
YF
NT seq 909 nt   +upstreamnt  +downstreamnt
atggatcaaaaacgacttacccacctgcggcaactggaggcggaaagcatccacattatt
cgcgaggtggcggcagaattctcaaatccggtgatgctctactctatcggtaaagattcc
agcgtcatgctgcatctggcgcgcaaggcgttttatccaggtacgctgcctttcccgttg
ctgcatgtcgataccggctggaaattccgcgagatgtatgagttccgcgatcgtacggct
aaagcctacggctgcgagctgctggtgcataaaaacccggaaggcgtagcgatggggatt
aatccattcgttcatggcagcgcgaaacataccgatattatgaaaactgaaggcctgaaa
caggcgctgaacaaatacggttttgatgccgccttcggtggtgcgcgccgcgacgaagag
aaatcccgcgctaaagagcgaatctactctttccgtgaccgcttccatcgctgggatccg
aaaaatcagcgcccggagctgtggcacaactacaacgggcaaattaacaaaggcgaaagc
atccgcgtcttcccgctctctaactggaccgagcaggatatctggcaatacatctggctg
gaaaatattgacattgttccactgtatctcgctgcggaacgtccggttctggaacgcgac
ggtatgttgatgatgattgatgacaaccgtatcgacctgcaaccgggcgaagtgattaaa
aaacggatggtgcgtttccgtacgctgggctgctggccgctgaccggcgcggtggagtca
aacgcacaaacactgccggagatcatcgaagagatgctggtttccaccaccagtgaacgt
cagggccgcgtaattgaccgcgaccaggcggggtctatggagctgaaaaaacgtcagggg
tatttttaa

DBGET integrated database retrieval system