KEGG   Escherichia coli NA114 (UPEC): ECNA114_2812Help
Entry
ECNA114_2812      CDS       T01998                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00052  Galactose metabolism
ena00500  Starch and sucrose metabolism
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ECNA114_2812
   00500 Starch and sucrose metabolism
    ECNA114_2812
Enzymes [BR:ena01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECNA114_2812
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AEG37647
Position
2868450..2869853
Genome map
AA seq 467 aa AA seqDB search
MPSQMPAILQAVMKGQSKALADAHYPCWHLAPVTGLMNDPNGFCWSGGRYHLFYQWNPLA
CDHKYKCWGHWSSTDLLHWQHEPLALMPDKEYDRNGCYSGSAVNNQGVLTLCYTGNVKFD
DGSRTAWQCLATENNQGGFDKLGPVIPLPDGYTGHVRDPKVWKHNSQWYMVLGAQDKEKR
GKVLLYSSVDLYTWSFHGEIAGNGLNEIDNAGYMWECPDLFALDGEYILLCCPQGMAREH
ERYLNTYPCAWLHGQFDYETGKFTHGAFSELDAGFEFYAPQTMEAPDGRRLLVGWMGVPD
GEEMLQPTRKHHWQHQMTCFRELSFQKGKLFQMPIRELAQLREAEHFWQGKADHAPHVEI
ERLEMDIIPSGELYLNFGNALALHLNDDGIQLQRRSLAGQEKLTRYWRGSVTSLKILCDS
SSVEIFINNGEGVMSNRYFPHHPASLILQGESDVTLRYWSLRACMVE
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgccttcacaaatgcccgcgattttacaggcagtgatgaaaggtcagtccaaagcactg
gcagatgcccactatccttgttggcatctcgctccagtcaccggactaatgaacgatcca
aatggcttttgttggtctggaggccgctatcatctgttttatcaatggaatccactggct
tgtgatcataagtacaaatgttgggggcactggagttcgacggatttattgcactggcag
catgaaccattagcgctaatgcccgataaagagtacgaccgtaatggttgttactcagga
agcgcggttaataatcagggcgttctcacactttgctataccggtaatgttaagtttgat
gatggcagcagaacagcatggcaatgtctggccaccgaaaataaccagggcgggtttgat
aaactaggccctgtcataccgttacctgatggttacaccggacatgttcgtgatccaaaa
gtctggaagcacaacagccaatggtacatggtgcttggcgcgcaagataaagagaaacgg
gggaaagtactgctgtattcctctgtcgatctctatacctggtcttttcatggagaaatt
gctggtaatggtctgaatgaaatagataacgcaggatacatgtgggaatgtcctgatctt
ttcgcccttgatggtgaatacattctcctctgctgcccccagggaatggcgcgcgaacat
gagcgctatctgaatacttatccctgcgcctggctacatggacagtttgattacgagaca
ggcaagtttacgcatggcgctttctcagagctggatgcgggatttgaattctatgcacca
cagacgatggaagccccggacgggcgacgattgctggtcggctggatgggggttcctgat
ggcgaagagatgttgcaaccaaccagaaagcatcattggcagcatcaaatgacctgtttt
cgcgaactctcattccagaagggaaaattgtttcagatgccaatcagggaactcgcgcaa
ctgcgtgaagctgaacacttctggcaaggaaaagcggatcatgcgccgcatgtcgaaatt
gaacgcctggaaatggacatcattccgtcgggtgagctgtatctgaattttggcaatgcg
ctggcactgcatcttaatgacgatggtattcaactacagaggagaagccttgcagggcaa
gagaaactaactcgttactggcgaggaagcgtaacgtcactgaagattctctgtgacagt
tccagcgtagagatattcatcaataatggtgaaggtgtaatgagtaatcgttattttccc
catcatccagcttcgctgatattacagggtgagtctgacgtcacgttacgctactggtcg
ctacgcgcctgcatggtagaatga

DBGET integrated database retrieval system