KEGG   Escherichia coli NA114 (UPEC): ECNA114_2855
Entry
ECNA114_2855      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K11900  type VI secretion system protein ImpC
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_2855
Secretion system [BR:ena02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECNA114_2855
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AEG37690
Position
2913826..2915364
AA seq 512 aa
MSVQQEHATSETATLTTTESGGVYQSLFDKINLTPVSSIQEIDSWQNSETLADASPDERV
TAAIHVLLSCLAKSGEDVVKLDKSLLDFHIDDLDQKISKQLDAVMHHPEFQKVESLWRGT
WFVVQRTDFRKNVRIELLDVSKEHLRQDFDDSPEIIQSGLYRHTYIQEYDTPGGEPVASL
ISSYEFDNSPQDIALLRNISRVSAASHMPFIGSVGPKFFLKNSMEEVAAIKDIGNYFDRA
EYIKWKSFRDTDDSRYVGLVMPRVLGRLPYGPDTVPVRSFNYVEEVKGPDHEKYLWTNAS
FAFAANMVKSFVNNGWCVQIRGPQAGGAVADLPIHLYDLGTGNQVKIPSEVMIPETREFE
FANLGFIPLSYYKNRDYACFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHYL
KIIQRENIGTTKDRRVLELELNTWIRTLVTEMTDPGDELQASHPLRDGKVIVEDIEDNPG
FFRVRLFAVPHFQIEGMDINLSLVSQMPKAKA
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtctgtacaacaagaacatgccacctctgaaactgcaacactcaccaccactgagtcc
ggcggcgtttatcagtccctgtttgataaaattaatttaaccccggtctcttccattcag
gaaatcgattcatggcaaaacagcgaaacgctggccgatgcctcacccgatgagcgcgtg
acggcggctatccacgttctgctttcctgtctggcgaagtctggcgaggacgtggttaaa
ctcgacaaaagcctgctggattttcatatcgacgatctggatcagaaaatcagtaaacag
cttgatgcagtcatgcaccatccggaattccagaaagtcgagtcgctctggcgcggcaca
tggttcgtcgtacagcgcactgattttcgcaaaaatgtcagaattgaactgctggatgtc
agtaaagaacatctgcggcaggactttgatgattctccggaaatcattcaaagtggttta
tatcgccatacatacattcaggagtacgatacgccgggtggcgaacctgtagcctcatta
atatccagctatgaattcgataacagcccgcaggatattgccctgctgcgtaatatttcc
agagtctctgctgcatcacatatgccctttatcggttccgtcggaccgaagttcttcctt
aaaaactcgatggaagaagtcgccgcaattaaagatatcggcaactattttgaccgcgcg
gaatatatcaaatggaagtcgttccgcgataccgacgacagtcgctacgtgggattagtg
atgccgcgcgtgctgggccgtctgccctatgggccggacacagtgccggtacgcagcttt
aactatgtggaagaagtcaaaggcccggatcacgaaaaatacctctggacaaacgcctcg
ttcgcctttgccgccaatatggtgaagagctttgtgaataatggctggtgcgtgcagatc
cgtggtccgcaggcgggtggcgcagtggccgatctgccgatccatctttacgatctcggc
accggcaatcaggtcaaaattccgtccgaagtgatgatcccggaaacccgcgaatttgaa
tttgccaaccttggctttattccgctctcttattataagaatcgcgattacgcctgcttc
ttctcagcgaactctgcccagaaaccggcgttgtatgataccgctgacgccaccgccaac
agtcgtattaacgcccgtttgccctatattttcctgctgtcccgcattgcgcattacctg
aaaatcatccagcgcgagaatatcggtaccaccaaagaccgccgcgtactggaactggag
cttaacacctggatccgcacactggtgacggagatgaccgatccgggtgatgaactgcag
gcgtctcacccgctgcgcgacggcaaggttatcgtggaagatattgaggacaatccgggc
ttcttccgcgtcagactctttgccgtgccgcatttccagattgaagggatggatatcaac
ctgtcactggtttcccagatgccgaaagcgaaagcctga

DBGET integrated database retrieval system