KEGG   Escherichia coli NA114 (UPEC): ECNA114_2861
Entry
ECNA114_2861      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ena00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECNA114_2861
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_2861
Secretion system [BR:ena02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECNA114_2861
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1 Laminin_II DUF1843
Other DBs
NCBI-ProteinID: AEG37697
Structure
PDB: 
2P5Z

Position
2922434..2925367
AA seq 977 aa
MNVQFFDHSHHKLKIRGLQSPVDVLTFEGREQLSTPFRYDIQFTSTDKAIAPESVLMQDG
AFSLTAPPVQGMPVQTALRTLHGVITSFKHLSSSQDEARYEVRLEPRMALLTRSRQNAIY
QNLTVPQIVEKILRERHQMRGQDFVFNLKNEYPAREQVMQYGEDDLTLHQMRGQDFVFNL
KSAYPSREQVMQYGEDDLTFVSRLLSEVGIWFRFATDARLKIEVVEFYDDQSGYERGLTL
PLRHPSGLFDGETEAVWGLNTAYSVVEKSVTTRDYNYRTATAEMMTEQHDATGGDNTTYG
ERGLTLPLRHPSGLFDGETEAVWGLNSAYSVVEKSVSTRDYNYREATAEMTTGQHDATGG
DNTTYGEAYHYADNFLQKGDKEAAESGAFYARIRHERYLNEQAILQGQSTSSLLMPGLEI
RVQGDDAPAVFRKGVLITGVTALNEQAILKGQSTSSLLMPGLEIKVQGDDAPAVFRKGVL
ITGVTASAARDRSYELTFTAIPYSERYGYRPALIPCPVMAGTLPARVTSTVKNDIYAHID
KDGRYRVNLDFDRDTWKPGYESLWVRQSRPYAGDTYGLHLPLLAGTEVSIAFEEGNPDRP
YIAGVKHDSAHTDHVTIQNYKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGH
LVDAGKQQRGEGFELRTDLWGTVRAKKGIFISSDAQDKAQGKVREMAPAMAILDGAQSQM
KSLSTDAQTANADPADLSSQIALLQQSVKDLTQAAILLSAPKGVAIASGEHLQLAASKNL
IANAGNHADIGVVKNMFIGVGQALSVFVRKAGIKLFANKGAISVQAQNDLMELLAQKSIE
ITSTEDEIKITAKKKITLNGGGSYIRLDACGIEAGTPGEYNVKAGYYGRKPKAKLTPELM
AFPVIKSEDFNQSFILLDENTGQPLINWPYELELESGLKMSGITDENGNTELISSDKEEV
VNISVFEPDEFLDDEIN
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgaacgtacagttcttcgaccactcacaccacaagctcaaaattcgcggcctgcaaagt
ccggtggatgtgctgaccttcgaaggccgcgaacaactgagtaccccgttccgctacgac
attcagtttaccagtaccgataaagccatcgcgccggagtcggtgctgatgcaggacggc
gcattcagcctgacggcaccgcccgtgcagggaatgccggtgcagactgccctgcgcacc
ctgcacggcgtcattaccagctttaaacacctctcctcgtcacaggacgaagcccgttac
gaagtgcgccttgaaccccgtatggcgctgcttacccgcagccgccagaacgccatctac
cagaatctgacggtgccgcaaatcgtcgaaaaaatcctgcgcgagcgccatcaaatgcgc
ggtcaggacttcgtgtttaacctcaaaaacgaatacccggcccgtgaacaggtgatgcag
tacggtgaggacgacctgacgttgcaccagatgcgcggtcaggacttcgtgtttaacctc
aaaagcgcatacccgtcccgcgaacaggtgatgcagtacggtgaggacgacctgacgttt
gtctcacgcctgctgtcggaagtgggtatctggttccgctttgccaccgacgcccggctg
aaaatcgaagttgtcgagttttatgacgaccagagcggctacgagcgcgggctgacactg
ccgcttcgccatccttcagggctgtttgatggtgaaacggaagcggtatgggggctgaat
accgcgtacagcgtggtggaaaaaagcgtcaccactcgggactacaactaccgcaccgcc
acagcagagatgatgacagagcagcatgacgccaccgggggcgataacaccacctacggt
gagcgcggactgacgctgccgcttcgtcatccttcagggctgtttgatggtgaaacggaa
gccgtatgggggttgaacagcgcgtacagcgtggtggaaaaaagcgtctccacgcgggac
tacaactaccgtgaagccacggcggaaatgaccacaggccagcatgacgccaccgggggc
gataacaccacctacggcgaagcctaccactatgccgacaacttcctgcaaaaaggcgat
aaagaggcagcggaaagcggcgcgttttatgcccgtatccgccacgaacgctatttgaat
gaacaggccattctacagggccagagcaccagttcactgctgatgccggggctggaaatc
agggttcagggcgacgacgcgccagcagtgttccgcaagggcgtactgattaccggcgtg
acggccctgaatgaacaggccattctcaaaggccagagcaccagttcactgctgatgccg
gggctggagataaaagttcagggtgacgacgcgccagcggtgttccgcaagggcgtactg
attaccggcgtgacggccagcgcggcgcgtgaccgcagctatgaactgacgtttaccgcc
atcccgtactcagaacgctatggctaccgcccggcgcttatcccctgccccgtgatggcc
ggcacgctcccggcacgggtcaccagcacggtgaagaacgacatctacgcccatatcgac
aaggacgggcgctaccgggtcaacctcgactttgaccgcgatacgtggaaaccgggttat
gaaagcctgtgggtacgccagtcgcgcccgtatgcgggagacacctacggcctgcatctg
ccgctgctggcgggaacggaagtcagcatcgcgtttgaggaaggcaacccggaccgacct
tatattgcaggcgtaaaacacgactcggcacacaccgaccatgtgaccattcagaactac
aagcgcaacgtactgcgcaccccggcgaacaacaaaatccgcctcgatgacgagcgcggc
aaagagcatatcaaggtcagtaccgagtatggcggcaagagccagctcaacctcggccat
ctggtggatgccggaaaacagcagcgcggggaaggctttgaactgcgtaccgatctgtgg
ggtacagtacgggcaaagaaaggcatctttatcagctccgacgcgcaggacaaggcgcag
ggtaaggtgcgcgaaatggctccggcgatggcaatactggatggcgcacagtcacagatg
aagtcgctgtccactgatgcgcagacggcgaatgccgatccggcagatctgtcatcacag
atagcgctgttgcagcagagtgtaaaagatctgacgcaggctgcgatcctgctaagcgca
cccaaaggcgtggcgatcgccagcggagagcacctgcaactggcggcgtcgaaaaacctg
atcgcgaacgcaggaaatcacgctgatatcggtgtcgtgaagaatatgtttatcggcgtg
ggtcaggcgctgagcgtgtttgtacgcaaagcgggtatcaaactgtttgccaataaaggg
gcgatctcggtacaggcacagaacgatctgatggaactgttggcgcagaaatcgatagag
atcaccagtacggaagatgagattaaaatcaccgcgaagaagaaaatcacccttaacggc
ggtggcagctacatccggctggatgcctgtgggatagaggccggtacgccgggagaatat
aacgttaaggcgggatattacgggcgtaagccgaaggcgaagctgacgccggagctgatg
gcatttccggtgattaagtctgaggattttaatcagagctttattttgctggatgaaaat
actgggcaaccacttattaattggccctatgaactagaactggaaagtgggctaaaaatg
agtgggattactgatgaaaatggaaatacagaactaatatcctctgataaggaggaggtc
gttaatattagtgtgtttgaacccgatgagtttttagacgatgaaattaattaa

DBGET integrated database retrieval system