KEGG   Escherichia coli NA114 (UPEC): ECNA114_2868
Entry
ECNA114_2868      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K11910  type VI secretion system protein VasJ
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_2868
Secretion system [BR:ena02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECNA114_2868
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N
Other DBs
NCBI-ProteinID: AEG37704
Position
2935456..2937081
AA seq 541 aa
MGKTPMSELLQKLTRSCFADRDALDVARTQAALWQTWLVPVTADTPVGEDPGYHDDFLRI
RDEMNKLSGADTGLICQLAESLLLTQAKDVRIATYYIWARLHRDGERGLAEGLALLAGLV
ERFGTQLLPSRPASRKMALEWLAGEKMLDSLARYPEVAKEDFANIVAALNQLSVSFTAWP
EDQHSPSLMPLINALESRLAQSGGMNAVVPQNSSGVPAPSSPVDAPQVQTITSGRDLLDQ
AKVLARYLNEQPQGWLSAHRLMKTLRWDTVHELPPDVDGKTRLAPPRTESRNQLKRLYAQ
QNWTELLEQADLMFSTGVSHFWLDIQWYLHQALAKAGAPWDRWTAVIRQDLALLLERLPG
LENLAWNDGTPFADEVTRNWIAQQVMMREDGAWLAGKAAVPTDDATNDVLALEPEALEMA
DSQGVEAALGWIQTRPGITTARQRLLLRLLMARVAEQYGKNEMALLLLEELDTAAQGITL
TQWEPELLFEVKARQLKLLRLRAHRYADKALLNRKMEILLGTLVAIDPVRAAVLCDTQHK
D
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggggaagacgccgatgagtgaactgttgcaaaagctgacccgtagctgttttgccgac
cgggatgcactggatgtggcgcgaacacaggcggcgctgtggcagacatggctggtgccg
gtgacggcagacacgccggtcggggaagaccccggctaccacgacgatttcctgcgtatc
cgcgacgaaatgaacaaactgtccggtgccgataccggccttatctgccagcttgccgaa
tccctgctgctgacgcaggccaaagacgtgcgcatcgccacttactacatctgggcgcga
ctgcaccgcgacggtgagcgcggactggctgaaggactggcgctgttagccgggctggtg
gaacgcttcggtacgcaactgctgccctcgcgaccggcaagccgaaaaatggcgctggag
tggctggcgggggaaaagatgctcgacagccttgcccgctacccggaggtggcaaaagag
gattttgcgaacattgttgccgctcttaatcaactgtcggtttccttcactgcatggccc
gaagaccagcattccccctccctgatgccgctgattaacgcgctggaatcacgtctggcg
cagtcgggcgggatgaacgcggtggtgccgcaaaacagcagcggcgttccggcaccgtct
tccccggtggatgcgccgcaggtacagaccatcacctccgggcgcgacctactcgaccag
gcgaaagtgctggcccgttatctgaacgaacagccgcagggctggctttcagcacaccgg
ctgatgaaaaccctgcgctgggacacggtgcatgaactgccgccggacgtggacggcaaa
acccggctggccccgccgcgcaccgaatcacgcaaccagcttaagcggctgtatgcccag
cagaactggacggaactgctggagcaggccgacctgatgttcagcaccggtgtcagccat
ttctggctggatatccagtggtatctgcatcaggcgctggcgaaggcgggcgcaccgtgg
gacagatggacagcggttatccgtcaggacctggcgctgctgctggagcgcctgccgggg
ctggaaaatctggcatggaacgacggcacgccgtttgccgatgaggtgacgcgcaactgg
atagcgcagcaggtcatgatgcgggaagacggcgcatggcttgcggggaaagccgctgtg
ccgacagacgacgccacaaatgacgtactggcgctggagccggaagcactggagatggct
gacagtcagggcgtggaagcggcgctgggctggatacagacccgtccgggcatcaccacg
gcacgacagcgcctgttattgcgactgctgatggcacgggtggcggaacagtacggtaaa
aacgagatggcgctcctgctgctggaagaactggataccgccgcacagggaataacgctg
acacagtgggagccagagctgctgtttgaagtaaaagcccgacaactgaaactgctgcgt
ctgcgggcgcaccgctatgcggataaagccctgctgaaccgaaaaatggaaatcctgctg
ggaacgctggtggcaatcgatccggtacgggcagcggtattgtgtgatacgcaacataag
gactga

DBGET integrated database retrieval system