KEGG   Escherichia coli NA114 (UPEC): ECNA114_2870
Entry
ECNA114_2870      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_2870
Secretion system [BR:ena02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECNA114_2870
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AEG37706
Position
2938417..2940177
AA seq 586 aa
MDDLTQRYFEAEMRYLREAGKEFAQAYPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTEGLVSLLWPHYLRTIPSLSVVELTTDHQQMKQSDTLKEFQVLSRPIGE
RRTRCVYSATRDITLHPLALPDVSLQYEPDGRSVIRLRFECGPLVGDWSQIDLSRLPLYL
SADSPVACALHRALTLGTQQFWLRLPGQGRRVLDAHFSPMGFDDDDRLWPKGESAFSGYQ
LLLEYFTFREKFMFVALNGLEQVAWPEGITGFEIDVLLNENWPHDLPFDSDNIRLHCVPV
INLFPLEADPLHLSPLENEFLLRPMRIQDGHTEIYSVDNIISSRHTGSQAYVPFSSFRHR
GGMLRHDAPERYYHTRVKRGPSGLHDTWLILGGDAFDTDRMLEDETLSLSLTGTNGQLPR
KALQSTLLDTPVHASQNVLRVRNLCAPTQPCYPPARDRFHWRVLSHLGSNFLSMMDNAEI
LRGTLALYDWTESEMNRRRLAAIVDVQHSLIQRFERGFLLRGVDIQVTLDSNGFAGEGDI
TLFGELLHRFFALYADIHLFTQLTLILQPTGKCLQWTEHHSQRVPG
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggacgacctgacccaacgctactttgaggccgaaatgcgctacctgcgtgaagcgggg
aaagaatttgcgcaggcttaccccgaccgcgctgcgatgcttaatcttgataaacccggc
gcacgcgatccctatgtggagcgcctgttcgagggcttcgcttttttaatgggccgcctg
cgcgaaaagctggacgacgatctgccggaactgactgaagggctggtcagcctgctgtgg
ccgcactacctgcgcactattccgtcgctttccgtggtcgaactgaccacggatcaccaa
caaatgaagcaaagtgatacgctgaaagagtttcaggtgctatcccgtcccatcggcgaa
cgcagaacccgctgcgtctacagcgccacgcgggatatcacgctgcatccgctggcgttg
ccggacgtgtcattgcaatatgaaccggacggacgctcggttatccgtctgcgctttgaa
tgcggcccgctggttggtgactggtcacagattgatttatcccgcctgccgctgtacctc
agtgccgacagcccggtggcctgtgcgctgcaccgggctttaacgcttggtacgcagcag
ttctggctgcgtctgccagggcagggacgccgtgtgctggacgcgcacttttccccgatg
ggttttgatgacgatgaccgactgtggccgaaaggcgaatcggcgttcagcggctaccag
ttgctgctggagtatttcaccttccgcgagaagtttatgttcgtggcgctgaacgggctg
gagcaggttgcatggccggaggggataaccggctttgagattgacgtgttgctgaacgag
aactggcctcacgacctgccgtttgacagcgataatatccgtctgcactgcgtgccggtc
atcaacctgtttccgctggaagccgatccgttacacctttcgccactggaaaacgaattt
ctgctgcgcccgatgcgcattcaggacgggcataccgagatttattccgtcgacaacatt
atttcttcgcgccataccggcagtcaggcgtatgtgccattctccagctttcgtcaccgg
ggcgggatgctgcgccacgatgcgccggaacgctattaccacacgcgggtaaagcgcggc
ccttccggcctgcatgacacctggctgattctgggcggcgatgcgtttgatactgaccgg
atgctggaggatgaaaccctgtccttaagcctgaccggtactaacgggcagcttccccgt
aaagctttacagagcacgctgctcgatacgccagttcatgcctcacagaacgtcctgcgg
gtgcgcaacctgtgcgccccgacgcagccctgctatcccccggcgcgtgaccgcttccac
tggcgggtgctcagccaccttggttctaactttttatcgatgatggataacgccgaaatt
ctgcgcggcacgctggcgctgtacgactggaccgaaagcgagatgaaccgccgtcgtctg
gcggcgattgtcgacgttcagcacagcctgatacagcgttttgaaagaggctttctgctg
cgtggcgtggatattcaggtgacgctggacagtaacggctttgccggagaaggtgatatc
acgctgtttggtgaactgctgcaccgcttcttcgcactgtatgccgatatccacttattc
actcaactaaccttaattctgcaacccacaggaaagtgcctgcaatggacagagcatcac
agccagcgcgtaccgggctga

DBGET integrated database retrieval system