KEGG   Escherichia coli NA114 (UPEC): ECNA114_2871
Entry
ECNA114_2871      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ena00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECNA114_2871
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_2871
Secretion system [BR:ena02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECNA114_2871
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AEG37708
Position
2941201..2941737
AA seq 178 aa
MFPIRFKRPALLCMAMLTVVLSGCGLIQKVVDESKSVASAVFYKQIKILHLDFFSRSALN
TDAEDTPLSTMVHVWQLKTREDFDKADYDTLFMQEEKTLEKNVLAKHTVWVKPEGTASLN
VPLDKETQFVAIIGQFYHPDEKSDSWRLVIKRDELEADKPRSIELMRSDLRLLPLKDK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgtttcctattcgttttaaacgtccggcgctgctctgtatggcgatgctgacggttgtt
ctgagcggctgcgggctgattcagaaagtggtggatgaatcgaaaagcgtggcctcagcc
gttttctacaagcaaatcaaaatactgcatctcgatttcttctcccgaagtgccctgaat
acggatgcggaagatacgccgctttccacgatggtgcatgtctggcaactgaaaacccgc
gaagattttgacaaggcggattatgacaccctgtttatgcaggaagagaagacgctggag
aagaacgtactggcaaaacacaccgtctgggtaaaaccggaaggcacggcatccctgaat
gtgccgctggataaagagacgcagtttgtcgccattattgggcagttttatcaccctgat
gaaaaaagcgacagctggcgtctggtgatcaaaagggacgaactggaggccgacaagccg
cgctcgattgaactgatgagaagcgacctgcgactgctgcctctcaaggataaataa

DBGET integrated database retrieval system