KEGG   Escherichia coli NA114 (UPEC): ECNA114_2872Help
Entry
ECNA114_2872      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ena02044]
    ECNA114_2872
Secretion system [BR:ena02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECNA114_2872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GPW_gp25
Motif
Other DBs
NCBI-ProteinID: AEG37709
Position
2941741..2942169
Genome map
AA seq 142 aa AA seqDB search
MSTPSLYEMLTFSFSGELPLEQVRERDQLILSVMDNMQRIINCRAGTLAHLPDYGLPDLS
LIHQGMAAGIHGLMRQIEETLLRYEPRLSQIQVELLPQPRPGHLNYLIHAQLPDTGWIRF
DGVFSPEGRIVLRHLKQQERAY
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaccttccttatatgaaatgctgacgttcagtttcagcggcgagttaccgctg
gaacaggtcagagagcgggatcagcttatcctttccgtgatggacaatatgcaacgcatt
atcaactgccgggcaggcacgctggcgcatttgccggattacggtctgccggatctcagt
ctgatccatcaggggatggctgcgggtattcatggcctgatgcgtcagattgaagaaacg
ctgctgcgttatgaaccacgcctgagtcagatacaggtggagttactcccccagccccgt
ccggggcatcttaattacctgatccacgcgcagcttcccgataccggctggatacgcttt
gatggcgtattttctccggaaggacgaattgttctgcgtcatctcaaacaacaggagcgg
gcgtactga

DBGET integrated database retrieval system