KEGG   Escherichia coli NA114 (UPEC): ECNA114_2876
Entry
ECNA114_2876      CDS       T01998                                 

Definition
(GenBank) N-acetylglutamate synthase
  KO
K14682  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00220  Arginine biosynthesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01210  2-Oxocarboxylic acid metabolism
ena01230  Biosynthesis of amino acids
Module
ena_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ECNA114_2876
Enzymes [BR:ena01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     ECNA114_2876
SSDB
Motif
Pfam: AA_kinase Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9
Other DBs
NCBI-ProteinID: AEG37713
Position
2946293..2947624
AA seq 443 aa
MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIGLLHSLGIRLV
VVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLDITARLSMSLNNTP
LQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHRQLDSGAIVLMGPVAVSV
TGESFNLTSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIVSELFPNEAQTRVEAQEEK
GDYNSGTVRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRR
ATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKI
GEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDL
LPESKKQLYNYQRKSKVLMADLG
NT seq 1332 nt   +upstreamnt  +downstreamnt
gtggtaaaggaacgtaaaaccgagctggtcgagggattccgccattcggttccctatatc
aatacccaccggggaaaaacgtttgtcatcatgctcggcggtgaagccattgagcatgag
aatttctccagtatcgttaatgatatcgggttgttgcacagcctcggcatccgtctggtg
gtggtctatggcgcacgtccgcagatcgacgcaaatctggctgcacatcaccacgaaccg
ctgtatcacaagaatatacgtgtgaccgacgccaaaacactggaactggtgaagcaggct
gcgggaacattgcaactggatattactgctcgcctgtcgatgagtctcaataacacaccg
ctgcagggcgcgcatatcaacgtcgtcagtggtaattttattattgcccagccgctgggc
gtcgatgacggcgtggattactgtcatagcgggcgtatccggcggattgatgaagacgcg
atccatcgtcaactggacagcggtgcaatagtgctaatggggccggtcgctgtttcggtc
actggcgagagctttaatctgacctcggaagagattgccactcaactggccatcaaactg
aaagctgaaaaaatgattggtttttgctcttcccagggcgtcactaatgacgacggtgat
attgtctccgaacttttccctaacgaagcgcaaacgcgggtagaagcccaggaagagaaa
ggcgattacaactccggtacggtgcgctttttgcgtggcgcagtgaaagcctgccgcagc
ggcgtgcgtcgctgtcatttaatcagttatcaggaagatggcgcgctattgcaagagttg
ttctcacgcgacggtatcggtacgcagattgtgatggaaagcgccgagcagattcgtcgc
gcaacaatcaacgatattggcggtattctggagttgattcgcccgctggagcaacaaggt
attctggtacgccgttctcgcgagcagctggagatggaaatcgacaaattcaccattatt
cagcgcgataacacgactattgcctgcgccgcgctctatccgttcccggaagagaagatt
ggggaaatggcctgtgtggcagttcacccggattaccgcagttcatcacggggcgaggtt
ctgctggaacgcattgccgctcaggcgaagcagagcggcttaagcaaattgtttgtgctg
accacgcgcagtattcactggttccaggaacgtggatttaccccagtggatattgattta
ctacccgagagcaaaaagcagttgtacaactaccagcgtaaatccaaagtgttgatggcg
gatttgggttaa

DBGET integrated database retrieval system