KEGG   Escherichia coli NA114 (UPEC): ECNA114_2879
Entry
ECNA114_2879      CDS       T01998                                 

Gene name
ptr
Definition
(GenBank) Protease III precursor
  KO
K01407  protease III [EC:3.4.24.55]
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ena01002]
    ECNA114_2879 (ptr)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.55  pitrilysin
     ECNA114_2879 (ptr)
Peptidases and inhibitors [BR:ena01002]
 Metallo peptidases
  Family M16: pitrilysin family
   ECNA114_2879 (ptr)
SSDB
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Other DBs
NCBI-ProteinID: AEG37716
Structure
PDB: 
1Q2L

Position
complement(2953067..2955955)
AA seq 962 aa
MPRSIWFKALLLFVALWAPLSQAETGWQPIQETIRKSDKDNRQYQAIRLDNGMVVLLVSD
PQAVKSLSALVVPVGSLEDPEAYQGLAHYLEHMSLMGSKKYPQADSLAEYLKMHGGSHNA
STAPYRTAFYLEVENDALPGAVDRLADAIAEPLLDKKYAERERNAVNAELTMARTRDGMR
MAQVSAETINPAHPGSKFSGGNLETLSDKPGNPVQQALKDFHEKYYSANLMKAVIYSNKP
LPELAKMAADTFGRVPNKESKKPEITVPVVTDAQKGIIIHYVPALPRKVLRVEFRIDNNS
AKFRSKTDELITYLIGNRSPGTLSDWLQKQGLVEGISANSDPIVNGNSGVLAISASLTDK
GLANRDQVVAAIFSYLNLLREKGIDKQYFDELANVLDIDFRYPSITRDMDYVEWLADTMI
RVPVEHTLDAVNIADRYDAKAVKERLAMMTPQNARIWYISPKEPHNKTAYFVDAPYQVDK
ISAQTFADWQKKAANIALSLPELNPYIPDDFSLIKSEKKYDHPELIVDESNLRVVYAPSR
YFASEPKADVSLILRNPKAMDSARNQVMFALNDYLAGLALDQLSNQASVGGISFSTNANN
GLMVNANGYTQRLPQLFQALLEGYFSYTATEDQLEQAKSWYNQMMDSAEKGKAFEQAIMP
AQMLSQVPYFSRDERRKILPSITLKEVLAYRDALKSGARPEFMVIGNMTEAQAITLARHV
QKQLGADGSEWCRNKDVVVDKKQSVIFEKAGNSTDSALAAVFVPTGYDEYTSSAYSSLLG
QIVQPWFYNQLRTEEQLGYAVFAFPMSVGRQWGMGFLLQSNDKQPSFLWERYKAFFPTAE
AKLRAMKPEEFAQIQQAVITQMLQAPQTLGEEASKLSKDFDRGNMRFDSRDKIVAQIKLL
TPQKIADFFHQAVVEPQGMAILSQISGSQNGKAEYVHPEGWKVWENVSALQQTMPLMSEK
NE
NT seq 2889 nt   +upstreamnt  +downstreamnt
atgccccgcagcatctggttcaaagcattattgttgtttgttgccctctgggcaccctta
agtcaggcagaaacgggatggcagccgattcaggaaaccatccgtaaaagtgataaagat
aaccgccagtatcaggctatacgtctggataacggtatggtggtcttactggtttctgat
ccgcaggcagttaaatcgctctcggcgctggtggtgcccgttgggtcgctggaagatcct
gaggcgtaccaggggctggcacattaccttgaacatatgagtctgatggggtcgaaaaag
tatccgcaggctgacagtctggccgaatatctcaaaatgcacggcggcagtcacaatgcc
agcacggcaccgtatcgcacggctttctatctggaagttgagaacgatgccttacccggt
gcggtagaccgcctggccgatgctattgcagaacccttgctcgacaagaaatacgccgaa
cgtgagcgtaatgcagtgaatgccgaattaaccatggcgcgtacgcgtgacgggatgcgc
atggcacaggtcagcgcagaaaccattaacccggcacaccccggttcaaagttttctggt
ggtaacctcgaaactttaagcgacaaaccaggtaatccggtacagcaggcgctgaaagat
ttccacgagaagtactattccgccaatctgatgaaggcggttatttacagcaataaaccg
ttgccggagttggcgaaaatggcggcggacacctttggtcgcgtgccgaacaaagagagc
aaaaaaccggaaatcaccgtgccggtagtcaccgacgcgcaaaagggcattatcattcat
tacgtcccggcgctgccgcgtaaagttctgcgcgttgagtttcgcatcgataacaattca
gcgaagttccgtagtaaaacggatgaattgattacctatctgattggtaatcgcagccct
ggtacactttctgactggctgcaaaagcagggattagttgagggcattagcgccaattcc
gatcctatcgtcaacggcaacagcggcgtattagcgatctctgcgtctttaaccgataaa
ggtctggcgaatcgcgatcaggttgtggcggccatttttagctacctcaatctgttacgt
gaaaaagggatcgataaacaatacttcgatgaactggcgaatgtgctggatatcgacttc
cgttatccgtcaatcacccgtgatatggattacgtcgaatggctggcagataccatgatt
cgcgttcctgttgagcatacactggatgcagtcaatattgccgatcggtacgacgctaaa
gcggtaaaagaacgtctggcgatgatgacgccacagaatgcgcgtatctggtatatcagc
ccgaaagagccgcacaacaaaacggcttactttgtcgatgcgccgtatcaggtcgataaa
attagcgcacaaactttcgctgactggcagaaaaaagccgccaatattgcgctctcctta
ccggagcttaacccctatattcctgacgatttctcgctgattaagtcagagaagaaatac
gaccatccagagttgattgttgatgagtcgaatctgcgcgtggtgtatgcgccaagccgt
tattttgccagcgagcccaaagctgatgtcagcctgattttgcgtaatccgaaagccatg
gacagcgcccgcaatcaggtgatgtttgcactcaatgattatctcgcagggctggcgctt
gatcagttaagcaaccaggcgtcggttggtggcataagtttttccaccaatgctaacaac
ggccttatggttaatgctaatggttacacccagcgtctgccgcagctgttccaggctctg
ctggagggctactttagctataccgctacggaagatcagcttgagcaggcgaagtcctgg
tataaccagatgatggattccgcagaaaagggcaaagcgttcgagcaggcgattatgccc
gcgcagatgctctcgcaagtgccgtacttctcgcgagatgaacggcgcaaaattttgccc
tccattacgttgaaagaggtgctggcctatcgcgacgccttaaaatcaggggctagacca
gagtttatggttatcggcaacatgactgaagcccaggcaataacgctggcacgccatgtg
caaaaacagttgggcgctgatggttcagagtggtgtcgtaacaaagatgtcgtggtcgat
aaaaaacaatccgtcatctttgaaaaagccggtaacagcaccgactccgcactggcagcg
gtatttgtaccgactggctacgatgaatacaccagctcagcgtatagttctctgttgggg
cagatcgtacagccgtggttctacaatcagttgcgtaccgaagaacagttgggctatgcc
gtgtttgcgtttccaatgagcgtggggcgtcagtggggcatgggcttccttttgcaaagc
aatgataaacagccttcattcttgtgggagcgttacaaggcgtttttcccaaccgcagag
gcaaaattgcgggcgatgaagccagaagagtttgcgcaaatccagcaggcggtaattacc
cagatgctgcaggcaccgcaaacgctcggcgaagaagcatcgaagttaagtaaagatttc
gatcgcggcaatatgcgcttcgattcgcgtgataaaatcgtggcccagataaaactgctg
acgccgcaaaaaattgctgatttcttccatcaggcggtggtcgagccgcaaggtatggct
attctgtcgcagatttccggcagccagaatgggaaagccgaatatgtgcatcctgaaggc
tggaaagtgtgggagaacgtcagcgcgttgcagcaaacaatgcccctgatgagtgaaaag
aatgagtga

DBGET integrated database retrieval system