KEGG   Escherichia coli NA114 (UPEC): ECNA114_2880
Entry
ECNA114_2880      CDS       T01998                                 

Gene name
recC
Definition
(GenBank) gamma chain of Exodeoxyribonuclease V
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ena00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    ECNA114_2880 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ena03400]
    ECNA114_2880 (recC)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ECNA114_2880 (recC)
DNA repair and recombination proteins [BR:ena03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ECNA114_2880 (recC)
SSDB
Motif
Pfam: Exonuc_V_gamma RecC_C
Other DBs
NCBI-ProteinID: AEG37717
Structure
PDB: 
3K70 5MBV 5LD2 1W36

Position
complement(2956131..2959499)
AA seq 1122 aa
MLRVYHSNRLDVLEALMEFIVERERLDDPFEPEMILVQSTGMAQWLQMTLSQKFGIAANI
DFPLPASFIWDMFVRVLPEIPKESAFNKQSMSWKLMTLLPQLLEREDFTLLRHYLTDDSD
KRKLFQLSSKAADLFDQYLVYRPDWLAQWETGHLVEGLGEAQAWQAPLWKALVEYTDELG
QPRWHRANLYQRFIETLESATTCPPGLPSRVFICGISALPPVYLQALQALGKHIEIHLLF
TNPCRYYWGDIKDPAYLAKLLTRQRRHSFEDRELPLFRDSENAGQLFNSDGEQDVGNPLL
ASWGKLGRDYIYLLSDLESSQELDAFVDVTPDNLLHNIQSDILELENRAVAGVNIEEFSR
SDNKRPLDPLDSSITFHVCHSPQREVEVLHDRLLAMLEEDPTLTPRDIIVMVADIDSYSP
FIQAVFGSAPADRYLPYAISDRRARQSHPVLEAFISLLSLPDSRFVSEDVLALLDVPVLA
ARFDITEEGLRYLRQWVNESGIRWGIDDDNVRELELPATGQHTWRFGLTRMLLGYAMESA
QGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWRRGLAQERPLEEWLPVCRDMLNAFFL
PDAETEAAMTLIEQQWQAIIAEGLGAQYGDAVPLSLLRDELAQRLDQERISQRFLAGPVN
ICTLMPMRSIPFKVVCLLGMNDGVYPRQLAPLGFDLMSQKPKRGDRSRRDDDRYLFLEAL
ISAQQKLYISYIGRSIQDNSERFPSVLVQELIDYIGQSHYLPGDEALNCDESEARVKAHL
TCLHTRMPFDPQNYQPGERQSYAREWLPAASQAGKAHSEFVQPLPFTLPETVPLETLQRF
WAHPVRAFFQMRLQVNFRTEDSEIPDTEPFILEGLSRYQINQQLLNALVEQDDAERLFRR
FRAAGDLPYGAFGEIFWETQCQEMQQLADRVIACRQPGQSMEIDLACNGVQITGWLPQVQ
PDGLLRWRPSLLSVAQGMQLWLEHLVYCASGGNGESRLFLRKDGEWRFPPLAAEQALHYL
SQLIEGYREGMSAPLLVLPESGGAWLKTCYDAQNDAMLDDDSTLQKARTKFLQAYEGNMM
VRGEGDDIWYQRLWRQLTPETMEAIVEQSQRFLLPLFRFNQS
NT seq 3369 nt   +upstreamnt  +downstreamnt
atgttaagggtctaccattccaatcgtctggacgtgctggaagcgttgatggagtttatt
gtcgaacgcgaacggctggacgatcctttcgaaccagagatgattctggtgcaaagtacc
ggtatggcacagtggctgcaaatgaccctgtcgcaaaagtttggtattgcggcaaacatt
gattttccgctgccagcgagctttatctgggatatgttcgtccgggtgttaccggagatc
cccaaagagagcgcctttaacaaacagagcatgagctggaaactgatgacactgctgccg
caactgttggagcgcgaagactttaccctgttgcggcattatctgactgacgatagtgac
aagcgaaaactgttccagctttcttcaaaagcggcggacctgtttgaccagtatctggtc
tatcgtccggactggctggcacagtgggaaacaggacatctggtagaagggttgggagaa
gcacaggcctggcaagcgccgttgtggaaggcgttggtggaatataccgacgaacttggg
caaccgcgctggcaccgcgccaatctctatcagcgctttatcgaaacgctggagtccgcg
acgacctgcccgccggggttaccttcgcgcgtctttatatgcggtatttccgcgttaccg
cctgtttatctccaggcgctacaggcgctgggtaaacatattgaaatccatctcctgttt
accaacccctgccgttattactggggcgacattaaagatcccgcttatctggcgaaacta
ctgactcgccagcgccgacacagttttgaagatcgcgaattaccgctatttcgcgacagc
gaaaatgccgggcagctctttaacagcgatggtgaacaggatgtcggcaacccgctgctg
gcttcatggggcaagcttgggcgcgactacatttatctcctttctgacctggagagtagc
caggagctggacgcttttgtcgatgtgacgccagataacctgctgcataatattcagtct
gacattctggaactggaaaaccgcgccgttgctggtgtgaacatcgaagagttttcccgt
agcgataacaaacgcccgcttgatccactggatagcagtatcaccttccacgtttgccat
agcccgcagcgtgaagttgaagttttacacgatcgcctgctggcgatgctggaggaagac
ccgacacttactccgcgcgacatcatcgtgatggtggctgatatcgacagctacagtccg
tttattcaggctgtgtttggtagcgcacctgcggatcgttacctgccttacgccatttcc
gaccgtcgggcgcggcagtcgcatcctgtacttgaagcgtttatcagcctgttatcgttg
ccagacagccgctttgtgtcggaagacgtgctggcattactggatgtgccggtgctggcg
gcgcggtttgacatcaccgaagaagggctgcgttatttacgccagtgggtcaacgagtcc
ggcattcgttgggggatagatgacgacaacgttcgcgagctggaacttcccgctaccggt
caacacacctggcggtttggcctgacgcgcatgttgctgggctacgcgatggagagcgcg
cagggcgagtggcaatcggttctaccttatgatgaatcgagcggcttaattgcagaactg
gtggggcatctggcttcactgctaatgcagctaaatatctggcgtcgcgggctggcgcag
gagcgtccgctggaagagtggttgccggtttgtcgcgatatgctcaacgccttcttcctg
ccggatgcggaaaccgaagcggcgatgacgctgatcgaacaacaatggcaggcgattatc
gccgaaggtttaggtgcgcagtatggcgacgcggtgccgctgtcactattgcgtgatgaa
ctggcacagcgcctggatcaagaacgtatcagccagcgttttctcgccggaccggttaac
atttgtactctgatgccaatgcgttcaattccgttcaaagtggtttgcctgctgggaatg
aacgacggcgtttatccacgtcagcttgcgccattgggctttgatctgatgagccagaaa
ccgaagcgtggcgaccgtagccgtcgcgatgacgaccgctatctgttcctggaagcgtta
atttccgcgcagcaaaaactctatatcagctatatcgggcgttccattcaggataacagt
gaacgtttcccgtcggtactggtgcaggaactgatcgactacatcgggcaaagccattat
ctaccgggcgatgaagcgctcaactgtgatgaaagcgaggcaagggtaaaagcgcatctt
acttgcctccatacccgaatgccgtttgatccacaaaactaccagccaggcgaacgacaa
agttatgctcgtgaatggctacctgcggccagccaggctggtaaagcacattctgaattt
gttcagccgctgccatttaccttaccggaaaccgtgccgctggaaacgctacaacgattc
tgggcacatccggtgcgggcatttttccagatgcgtttgcaggtgaacttccgtaccgaa
gacagcgaaatccccgacaccgagccatttattctggaaggacttagccgttatcaaatc
aatcagcagttattgaatgcactggttgagcaggatgatgccgaacgcttgttccgtcgc
ttccgggcggcaggggatttaccgtatggcgcttttggtgaaattttctgggaaacgcag
tgtcaggagatgcagcagcttgccgacagagtcattgcctgtcgccagccggggcagagt
atggagattgatctcgcctgcaacggtgtgcaaataacgggctggttgccgcaggtgcag
ccggatggcctgttgcgctggcgtccctctttattaagtgtggcgcagggaatgcaactt
tggctggaacaccttgtctactgtgccagcggtggtaatggtgaaagtcgcctttttcta
cgcaaagacggcgagtggcgttttccgccgcttgcagccgaacaggctttgcattacctc
tcacaactgattgaggggtatcgtgaaggaatgtccgcgccattgctggtgttacctgaa
agtggcggcgcgtggctaaaaacctgttatgacgcgcaaaacgatgccatgctggatgac
gattccacgttgcaaaaagcccgtacgaaattccttcaggcttacgaaggcaacatgatg
gtgcgtggcgaaggtgatgatatctggtatcaacggctctggcggcaattaacaccagag
acaatggaggctatcgttgaacagtcgcaacgtttcctgttaccgctgtttcgctttaat
cagtcatga

DBGET integrated database retrieval system